GT-CORE (public beta v1)

Glycosyltransferase Curated Online Resource for Enzymology

Family-organised sequence, structure, mechanism and substrate-specificity records for the CAZy glycosyltransferases

UGAT

Bellis perennis · Cyanidin-3-O-glucoside 2-O-glucuronosyltransferase (EC 2.4.1.254)

GT1Non-model organism · annotation 4–5Fold GT-BInverting

External resources

Identification and annotation

CAZy familyGT1 · CAZy entry
Gene symbolUGAT
Synonyms / alternate names
  • UGT94B1
  • UDP-glucuronic acid:anthocyanin glucuronosyltransferase
UniProt accessionQ5NTH0
NCBI Gene IDnot curated
Source speciesBellis perennis
Taxonomic domainEukaryota
UniProt annotation level5

Function and localisation

Enzyme functionCyanidin-3-O-glucoside 2-O-glucuronosyltransferase (EC 2.4.1.254)
Subcellular locationCytoplasm

Structure and mechanism

Fold typeGT-B
Catalytic mechanismInverting
Cation dependenceNo
Oligomeric statemonomer
PDB structuresnot curated

Donor and acceptor specificity

Sugar nucleotide donorUDP-alpha-D-glucuronate
Donor CCD code(s)UGA
Acceptor substrate(s)cyanidin 3-O-beta-D-glucoside
Acceptor CCD / GlycoCTcyanidin

Protein sequences

Full protein sequence

438 aa
MDSKIDSKTFRVVMLPWLAYSHISRFLVFAKRLTNHNFHIYICSSQTNMQYLKNNLTSQYSKSIQLIELNLPSSSELPLQYHTTHGLPPHLTKTLSDDYQKSGPDFETILIKLNPHLVIYDFNQLWAPEVASTLHIPSIQLLSGCVALYALDAHLYTKPLDENLAKFPFPEIYPKNRDIPKGGSKYIERFVDCMRRSCEIILVRSTMELEGKYIDYLSKTLGKKVLPVGPLVQEASLLQDDHIWIMKWLDKKEESSVVFVCFGSEYILSDNEIEDIAYGLELSQVSFVWAIRAKTSALNGFIDRVGDKGLVIDKWVPQANILSHSSTGGFISHCGWSSTMESIRYGVPIIAMPMQFDQPYNARLMETVGAGIEVGRDGEGRLKREEIAAVVRKVVVEDSGESIREKAKELGEIMKKNMEAEVDGIVIENLVKLCEMNN

Catalytic domain sequence

420 aa
RVVMLPWLAYSHISRFLVFAKRLTNHNFHIYICSSQTNMQYLKNNLTSQYSKSIQLIELNLPSSSELPLQYHTTHGLPPHLTKTLSDDYQKSGPDFETILIKLNPHLVIYDFNQLWAPEVASTLHIPSIQLLSGCVALYALDAHLYTKPLDENLAKFPFPEIYPKNRDIPKGGSKYIERFVDCMRRSCEIILVRSTMELEGKYIDYLSKTLGKKVLPVGPLVQEASLLQDDHIWIMKWLDKKEESSVVFVCFGSEYILSDNEIEDIAYGLELSQVSFVWAIRAKTSALNGFIDRVGDKGLVIDKWVPQANILSHSSTGGFISHCGWSSTMESIRYGVPIIAMPMQFDQPYNARLMETVGAGIEVGRDGEGRLKREEIAAVVRKVVVEDSGESIREKAKELGEIMKKNMEAEVDGIVIENL