Home/GT Families/GT10/fut-6
fut-6
Caenorhabditis elegans · Alpha-(1,3)-fucosyltransferase fut-6 (EC 2.4.1.-)
GT10Model organism · annotation ≥ 4Fold GT-BInverting
External resources
Identification and annotation
| CAZy family | GT10 · CAZy entry |
|---|
| Gene symbol | fut-6 |
|---|
| Synonyms / alternate names | CEFT-3 |
|---|
| UniProt accession | G5EEE1 |
|---|
| NCBI Gene ID | 188084 |
|---|
| Source species | Caenorhabditis elegans |
|---|
| Taxonomic domain | Eukaryota |
|---|
| UniProt annotation level | 5 |
|---|
Function and localisation
| Enzyme function | Alpha-(1,3)-fucosyltransferase fut-6 (EC 2.4.1.-) |
|---|
| Subcellular location | - Golgi apparatus
- Golgi stack membrane
|
|---|
Structure and mechanism
| Fold type | GT-B |
|---|
| Catalytic mechanism | Inverting |
|---|
| Cation dependence | No |
|---|
| Oligomeric state | not curated |
|---|
| PDB structures | not curated |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | not curated |
|---|
| Donor CCD code(s) | not curated |
|---|
| Acceptor substrate(s) | not curated |
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
392 aa
MSQIGGATCTWRYLGRFVTLGIYASVALFVWYTLVPTRSKHKDSIAINNNNADPATALIPVHTKNVVIYAATKFFGHPITTERFLATCPDVQNYCRITQEESEFDNADAVLFHNADYRGSTDKFKKMKSQRKPGVPYVLWSLESPTNDMFRPDSHMINWTMTYRTDSDVWAPYGTIVKLKNPVEVDLNAIWEGKTKTATWLASNCITQNHRFDLIKKIIDNGFEIDIWGNCGKQVSQCAGVDNQESPCVLELIKPYKFYISMENSNCKDYVTEKFWKALNDRMTIPIVLARKYYKDLGVPDSAYIAVDDYATLDEFLAHVKKVNKEKDLFLSYHQWRKEWKVIIGSGFSGWCTLCNKLQDKDYILKNPKSYKDVAWWHSFEMCNNQIASKYL
Catalytic domain sequence
187 aa
WEGKTKTATWLASNCITQNHRFDLIKKIIDNGFEIDIWGNCGKQVSQCAGVDNQESPCVLELIKPYKFYISMENSNCKDYVTEKFWKALNDRMTIPIVLARKYYKDLGVPDSAYIAVDDYATLDEFLAHVKKVNKEKDLFLSYHQWRKEWKVIIGSGFSGWCTLCNKLQDKDYILKNPKSYKDVAWW
