Home/GT Families/GT101/gly
gly
Streptococcus gordonii · Probable glycosyl transferase Gly
GT101Lower annotation levelFold GT-BNot knownannotation < 4
External resources
Identification and annotation
| CAZy family | GT101 · CAZy entry |
| Gene symbol | gly |
| Synonyms / alternate names | not curated |
| UniProt accession | Q9AEU2 |
| NCBI Gene ID | not curated |
| Source species | Streptococcus gordonii |
| Taxonomic domain | Bacteria |
| UniProt annotation level | 3 below level 4 |
Function and localisation
| Enzyme function | Probable glycosyl transferase Gly |
| Subcellular location | not curated |
Structure and mechanism
| Fold type | GT-B |
| Catalytic mechanism | Not known |
| Cation dependence | No |
| Oligomeric state | Part of the accessory SecA2/SecY2 protein translocation appa |
| PDB structures | not curated |
Donor and acceptor specificity
| Sugar nucleotide donor | not curated |
| Donor CCD code(s) | not curated |
| Acceptor substrate(s) | not curated |
| Acceptor CCD / GlycoCT | not curated |
Protein sequences
Full protein sequence
682 aa
MDKLENKSMANYDEYRAVVICASFSDCNQVLTTIKSIVCHNRFIKFYVINNDFPTEWFVSMQKKLAKLDCPIVNARVDASLVSNFKTDISYTVFLRYFVADFVEEEQALYLDCDIVVTRDLSEIFAVDLGSHPLVAVRDLGGEVYFGEQIFNSGVLLINVNYWRENDIAGQLIEMTDNLHDKVTQDDQSILNMFFENRWVELPFPYNCITLHTTFSDYEPEKGLYPPVIHYLPERKPWKEYTQSIYREVWWFYQGLDWSDIQEPVGALTQKMVEGEDDSSLSCLVYTYSCDLLHINYLIQALPSCHFYIAAPVVVAEPITRLLQYPNVSVSSDIAGIPALLESLEAKSQLLLDINAGDEVGDIIARFKSSGKPVFAFDSTVHGQQGQEVFPADNPEVMVQAIEKLGLAEPEERQISVLSIDQSLDYLLEKGASVVRFGDGEMDLIAGRGIPYQEYDPELSARLREMMAMESNERLMICLSDVFTGLERYSIDAQNFWKAHLQHHLADYLEICRAPWYGSTFISRPYIDLEDKTPSAGYFAKLKQLWQDKDLLIVEGLTSRSGVGNDLFDGARSIKRIICPSRNAYSKLEAIKQAVREHADNRLILTMLGPTAKVLVYDLVQEGYRALDIGHIDSEYEWFQMGASHKIKLSHKHTAEHNFDQDIEYRDDQAYDSQIVANLAQE
Catalytic domain sequence
224 aa
VVRFGDGEMDLIAGRGIPYQEYDPELSARLREMMAMESNERLMICLSDVFTGLERYSIDAQNFWKAHLQHHLADYLEICRAPWYGSTFISRPYIDLEDKTPSAGYFAKLKQLWQDKDLLIVEGLTSRSGVGNDLFDGARSIKRIICPSRNAYSKLEAIKQAVREHADNRLILTMLGPTAKVLVYDLVQEGYRALDIGHIDSEYEWFQMGASHKIKLSHKHTAEH