Home/GT Families/GT108/LMJF_10_1240
LMJF_10_1240
Leishmania major · Correct this entry
GT108Model organism · annotation ≥ 4Fold beta-propellerInvertingannotation < 4
External resources
Identification and annotation
| CAZy family | GT108 · CAZy entry |
| Gene symbol | LMJF_10_1240 |
| Synonyms / alternate names | not curated |
| UniProt accession | Q4QH88 |
| NCBI Gene ID | 5649734 |
| Source species | Leishmania major |
| Taxonomic domain | Eukaryota |
| UniProt annotation level | 1 below level 4 |
Function and localisation
| Enzyme function | Correct this entry |
| Subcellular location | not curated |
Structure and mechanism
| Fold type | beta-propeller |
| Catalytic mechanism | Inverting |
| Cation dependence | No |
| Oligomeric state | not curated |
| PDB structures | not curated |
Donor and acceptor specificity
| Sugar nucleotide donor | not curated |
| Donor CCD code(s) | not curated |
| Acceptor substrate(s) | not curated |
| Acceptor CCD / GlycoCT | not curated |
Protein sequences
Full protein sequence
321 aa
MGLLNTKPCSLIPAKEAFEREKKIYDKAILSFDGVNGYDVYNCSVPFTYDGKTYIFGRVEKKDEWVHSNSILFEKVGENRYRRHPTSITYNLEDPFVVKIHGEMVLGGTHVTKNGGKVSDYRCEFYHGTPLNLKYFSSGPSKMKDIRLVELADGKIGVFTHFRTEGSCLTGFATIDKIEDLTVEVINSAKLINHRPFGDAWGGPSQVYLLSSGLLGCISHHGYLLDQKDDIQLRIYACTSFVFDPATYDVYNFKIIGTKGCFPPCEPKLPHLADCAFVSGIEMRDDGKCNLYSGIGDVAEGCIVIDYPFEGYGKIVSDVAF
Catalytic domain sequence
295 aa
AFEREKKIYDKAILSFDGVNGYDVYNCSVPFTYDGKTYIFGRVEKKDEWVHSNSILFEKVGENRYRRHPTSITYNLEDPFVVKIHGEMVLGGTHVTKNGGKVSDYRCEFYHGTPLNLKYFSSGPSKMKDIRLVELADGKIGVFTHFRTEGSCLTGFATIDKIEDLTVEVINSAKLINHRPFGDAWGGPSQVYLLSSGLLGCISHHGYLLDQKDDIQLRIYACTSFVFDPATYDVYNFKIIGTKGCFPPCEPKLPHLADCAFVSGIEMRDDGKCNLYSGIGDVAEGCIVIDYPFEG