GT-CORE (public beta v1)

Glycosyltransferase Curated Online Resource for Enzymology

Family-organised sequence, structure, mechanism and substrate-specificity records for the CAZy glycosyltransferases

FUT2

Homo sapiens · L-Fucosyltransferase (EC 2.4.1.-)

GT11Model organism · annotation ≥ 4Fold GT-BInverting

External resources

Identification and annotation

CAZy familyGT11 · CAZy entry
Gene symbolFUT2
Synonyms / alternate namesnot curated
UniProt accessionA0A7M4CF04
NCBI Gene IDnot curated
Source speciesHomo sapiens
Taxonomic domainEukaryota
UniProt annotation level4

Function and localisation

Enzyme functionL-Fucosyltransferase (EC 2.4.1.-)
Subcellular location
  • Golgi apparatus
  • Golgi stack membrane

Structure and mechanism

Fold typeGT-B
Catalytic mechanismInverting
Cation dependenceNo
Oligomeric statenot curated
PDB structuresnot curated

Donor and acceptor specificity

Sugar nucleotide donorGDP-beta-L-fucose
Donor CCD code(s)GFB
Acceptor substrate(s)
  • Lc4Cer
  • a beta-D-Gal-(1->3)-beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1')-Cer(d18:1(4E))
  • a beta-D-galactosyl-(1->3)-N-acetyl-beta-D-glucosaminyl derivative
  • a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative
  • a ganglioside GA1
  • a ganglioside GD1b
  • a ganglioside GM1 (d18:1(4E))
  • a ganglioside GM1
  • a globoside GalGb4Cer (d18:1(4E))
  • a lactoside III(4)-a-Fuc-Lc4Cer
  • a neolactoside nLc4Cer
  • a neolactoside nLc4Cer(d18:1(4E))
  • beta-D-galactosyl-(1->3)-N-acetyl-D-galactosamine
Acceptor CCD / GlycoCTnot curated

Protein sequences

Full protein sequence

150 aa
VQMPFSFPMAHFILFVFTVSTIFHVQQRLAKIQAMWELPVQIPVLASTSKALGPSQLRGMWTINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQMHSTLAPIFRITLPVLHSATASRIPWQNYHLNDWMEEEYRHIPGEYVRFTGYPCS

Catalytic domain sequence

133 aa
TVSTIFHVQQRLAKIQAMWELPVQIPVLASTSKALGPSQLRGMWTINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQMHSTLAPIFRITLPVLHSATASRIPWQNYHLNDWMEEEYRHIPGEYVRFTGYPCS