Home/GT Families/GT11/Sec1
Sec1
Mus musculus · Galactoside 2-alpha-L-fucosyltransferase Sec1 (EC 2.4.1.-)
GT11Non-model organism · annotation 4–5Fold GT-BInverting
External resources
Identification and annotation
| CAZy family | GT11 · CAZy entry |
| Gene symbol | Sec1 |
| Synonyms / alternate names | - Fut3
- Alpha(1,2)FT 3
- GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 3
- Secretory blood group protein 1
|
| UniProt accession | P97353 |
| NCBI Gene ID | not curated |
| Source species | Mus musculus |
| Taxonomic domain | Eukaryota |
| UniProt annotation level | 5 |
Function and localisation
| Enzyme function | Galactoside 2-alpha-L-fucosyltransferase Sec1 (EC 2.4.1.-) |
| Subcellular location | - Golgi apparatus
- Golgi stack membrane
|
Structure and mechanism
| Fold type | GT-B |
| Catalytic mechanism | Inverting |
| Cation dependence | No |
| Oligomeric state | not curated |
| PDB structures | not curated |
Donor and acceptor specificity
| Sugar nucleotide donor | GDP-beta-L-fucose |
| Donor CCD code(s) | GFB |
| Acceptor substrate(s) | a ganglioside GM1 |
| Acceptor CCD / GlycoCT | not curated |
Protein sequences
Full protein sequence
368 aa
MPSDSCLLSLTVLQRLRAICPPLSTFYLFFVIFVVSTIFHCHRRLGLVPAPWASPSLVVFPPRHMPREGMFTIRVKGRLGNQMGEYATLFALARMNGRLAFIPASMHSTLAPIFRISLPVLHSDTAKRIPWQNYHLNDWMEERYRHIPGHYVRFTGYPCSWTFYHHLRPEILKEFTLHDHVREEAQAFLRGLQVNGSQPSTFVGVHVRRGDYVRVMPKVWKGVVADRGYLEKALDRFRARYSSPVFVVTSDDMAWCRKSITASRGDVAFAGNGLQGSPAKDIALLMQCNHTVITLGTFGIWAAYLTGGDTVYLANFTQPNSPFHTVFKPEAAYLPEWVGIAADLGQPNTVGSGHASARAPKRHWGALL
Catalytic domain sequence
308 aa
VVSTIFHCHRRLGLVPAPWASPSLVVFPPRHMPREGMFTIRVKGRLGNQMGEYATLFALARMNGRLAFIPASMHSTLAPIFRISLPVLHSDTAKRIPWQNYHLNDWMEERYRHIPGHYVRFTGYPCSWTFYHHLRPEILKEFTLHDHVREEAQAFLRGLQVNGSQPSTFVGVHVRRGDYVRVMPKVWKGVVADRGYLEKALDRFRARYSSPVFVVTSDDMAWCRKSITASRGDVAFAGNGLQGSPAKDIALLMQCNHTVITLGTFGIWAAYLTGGDTVYLANFTQPNSPFHTVFKPEAAYLPEWVGIA