Home/GT Families/GT112/aah
aah
Escherichia coli · Autotransporter heptosyltransferase Aah (EC 2.4.99.-)
GT112Model organism · annotation ≥ 4Fold GT-BRetaining
External resources
Identification and annotation
| CAZy family | GT112 · CAZy entry |
|---|
| Gene symbol | aah |
|---|
| Synonyms / alternate names | - AIDA-associated heptosyltransferase
- Autotransporter adhesin heptosyltransferase
|
|---|
| UniProt accession | Q93K96 |
|---|
| NCBI Gene ID | not curated |
|---|
| Source species | Escherichia coli |
|---|
| Taxonomic domain | Bacteria |
|---|
| UniProt annotation level | 5 |
|---|
Function and localisation
| Enzyme function | Autotransporter heptosyltransferase Aah (EC 2.4.99.-) |
|---|
| Subcellular location | not curated |
|---|
Structure and mechanism
| Fold type | GT-B |
|---|
| Catalytic mechanism | Retaining |
|---|
| Cation dependence | No |
|---|
| Oligomeric state | Homododecamer composed of 6 homodimers forming a ring |
|---|
| PDB structures | not curated |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | - ADP-D-glycero-beta-D-manno-heptose
- ADP-L-glycero-beta-D-manno-heptose
|
|---|
| Donor CCD code(s) | not curated |
|---|
| Acceptor substrate(s) | L-seryl-[protein] |
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
391 aa
MTFLSPPEIPTIKADNGTYYDFNNGARILFPKGEWHVNIIDEESGNILFSCDTKAGWVTSTKKYYVKFRIQAFKKGDEKPFLDTVMELKDKPVLISFPTGTLGDIIAWFHYAEKFRIKHQCKLECSVSEEFITLLSDNYPDIKFTSAQDKYEGKPYATYRIGLFFNGDTDNQPVDFRLVGFHRNAGYILGVSPQEDPPRLNLSAERKIQEPYVCIAVQSTAQAKHWNNGLGWAEVVRYLKELGYRVLCIDRNAHAGNGFVWNHIPWGAEDFTGALPLQERVDLLRHASFFVGLSSGLSWLAWASRIPVVLISGFSRPDSEFYTPWRVFNSHGCNGCWDNTNYNFDHTDFLWCPVHKGTDRQFECTRLITGKQVCGVIRTLHSYLTNHDRII
Catalytic domain sequence
176 aa
RLVGFHRNAGYILGVSPQEDPPRLNLSAERKIQEPYVCIAVQSTAQAKHWNNGLGWAEVVRYLKELGYRVLCIDRNAHAGNGFVWNHIPWGAEDFTGALPLQERVDLLRHASFFVGLSSGLSWLAWASRIPVVLISGFSRPDSEFYTPWRVFNSHGCNGCWDNTNYNFDHTDFLWC
