Home/GT Families/GT112/bimC
bimC
Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264) · Inactive autotransporter heptosyltransferase BimC
GT112Non-model organism · annotation 4–5Fold GT-BRetaining
External resources
Identification and annotation
| CAZy family | GT112 · CAZy entry |
|---|
| Gene symbol | bimC |
|---|
| Synonyms / alternate names | not curated |
|---|
| UniProt accession | Q2T6X6 |
|---|
| NCBI Gene ID | not curated |
|---|
| Source species | Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264) |
|---|
| Taxonomic domain | Bacteria |
|---|
| UniProt annotation level | 5 |
|---|
Function and localisation
| Enzyme function | Inactive autotransporter heptosyltransferase BimC |
|---|
| Subcellular location | not curated |
|---|
Structure and mechanism
| Fold type | GT-B |
|---|
| Catalytic mechanism | Retaining |
|---|
| Cation dependence | No |
|---|
| Oligomeric state | homotrimer |
|---|
| PDB structures | not curated |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | not curated |
|---|
| Donor CCD code(s) | not curated |
|---|
| Acceptor substrate(s) | not curated |
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
423 aa
MPKVTFSGSAPTLGVHAPPALDPRQPASPPPAASNGTHARGFSPPADMPTWSGTEGVRFDFNDGCRVLLPDGDWTVRLRDMHTDTPLFDAQIGAGVVTSTRKHFVPFLIEIDAGGRRVFKHLFDAHGKPVLIQFEAQRLGEALGWFGYAVKFQRQHRCKLTCSMPAPLIALLRPGYPDIEFVTPELVKPECYYATYRLGRFAGDEAHAYQPSAPQLVGAHRSAAYMLGVDPREAPPRIELTDDSRPLAGPYVCIAAQSALRCARWERPGGWRELQRFLTAAGYRIVCVDSPSPDVADESSALADVAYSLAPDTPWTERARWLRHAACLIGVPGDLSWLAWAVGAPVVLISGFTHPVSEFDTPYRVINSHACNSCWNDASANFDDADASSCPRHAGTLRQFECARLVSVEQIKRTIRSIPGIAC
Catalytic domain sequence
111 aa
LAGPYVCIAAQSALRCARWERPGGWRELQRFLTAAGYRIVCVDSPSPDVADESSALADVAYSLAPDTPWTERARWLRHAACLIGVPGDLSWLAWAVGAPVVLISGFTHPVS
