Home/GT Families/GT114/b107L
b107L
Paramecium bursaria Chlorella virus NY2A · Uncharacterized protein b107L
GT114Lower annotation levelFold GT-BInvertingannotation < 4
External resources
Identification and annotation
| CAZy family | GT114 · CAZy entry |
|---|
| Gene symbol | b107L |
|---|
| Synonyms / alternate names | not curated |
|---|
| UniProt accession | A7IVY2 |
|---|
| NCBI Gene ID | 5658828 |
|---|
| Source species | Paramecium bursaria Chlorella virus NY2A |
|---|
| Taxonomic domain | Viruses |
|---|
| UniProt annotation level | 1 below level 4 |
|---|
Function and localisation
| Enzyme function | Uncharacterized protein b107L |
|---|
| Subcellular location | not curated |
|---|
Structure and mechanism
| Fold type | GT-B |
|---|
| Catalytic mechanism | Inverting |
|---|
| Cation dependence | No |
|---|
| Oligomeric state | not curated |
|---|
| PDB structures | not curated |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | not curated |
|---|
| Donor CCD code(s) | not curated |
|---|
| Acceptor substrate(s) | not curated |
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
288 aa
MKISYGIVMKLAELTLESDDFITSDKLYDFCKSMKFGATYVKTDFIKFRTYQYIVSNSGWRNDNNIVFLEITPVLVTGHSDYDISERELDIIRLPNLRAWFCQNRNIQHPKVIAFPLGITNKDEPNSEIHRIIGNTDRILEVSKTPKDIKNLVYLNITVKNFPEERQKIIDLYSDKPWVTVGKCEITEEGHRKFLEDIYSCRFCFAPRGNGIDTHRIYESLYLRTIPIVKKHIAMEQFTDLPILFVDNWDNITEEYLNEQYDIIMAKDWNLDKLKINYWYQKILEYTQ
Catalytic domain sequence
not curated
