Home/GT Families/GT115/Saci_1262
Saci_1262
Sulfolobus acidocaldarius DSM 639 · UDP-GlcNAc:Dol-PP-GlcNAc beta-1,4-GlcNAc-transferase (EC 2.4.1.-); transfers second GlcNAc in archaeal N-linked glycosylation pathway
GT115Model organism · annotation ≥ 4Fold GT-BInvertingannotation < 4
External resources
Identification and annotation
| CAZy family | GT115 · CAZy entry |
|---|
| Gene symbol | Saci_1262 |
|---|
| Synonyms / alternate names | not curated |
|---|
| UniProt accession | Q4J9C3 |
|---|
| NCBI Gene ID | not curated |
|---|
| Source species | Sulfolobus acidocaldarius DSM 639 |
|---|
| Taxonomic domain | Archaea |
|---|
| UniProt annotation level | 1 below level 4 |
|---|
Function and localisation
| Enzyme function | UDP-GlcNAc:Dol-PP-GlcNAc beta-1,4-GlcNAc-transferase (EC 2.4.1.-); transfers second GlcNAc in archaeal N-linked glycosylation pathway |
|---|
| Subcellular location | Membrane |
|---|
Structure and mechanism
| Fold type | GT-B |
|---|
| Catalytic mechanism | Inverting |
|---|
| Cation dependence | No |
|---|
| Oligomeric state | not curated |
|---|
| PDB structures | not curated |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | UDP-N-acetyl-alpha-D-glucosamine |
|---|
| Donor CCD code(s) | UD1 |
|---|
| Acceptor substrate(s) | Dolichyl-PP-GlcNAc (Dol-PP-GlcNAc) |
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
309 aa
MIDNPLLIIASGGGHTGFARAIAEYLPFKPDFVIPENDRFSKDMLLDYARKLYYVKKGKDVIVMNSSPDSILEFISDMYENDNLQFICDIAPIDYNQAVRNYPDFINKAIKPDIVLHMLDDFGKPRLYIQRQTNLKRVFKSQYLTLFSPEEFKNFLKRFNKKLIKVHPSSDIVKKLKEEGFSNELIQVKKKEPLLKKIPSPESIRQELEKRDKEFIDILDAIRENKLDINNIAYISNRSLSQISTLINEILENFQKQYQIISDINMRKEKYAQSIIKYLNKTLNQKNNNLTTFKEDFDNKFLSELKQIK
Catalytic domain sequence
not curated
