Home/GT Families/GT119/spoVE
spoVE
Bacillus subtilis (strain 168) · Stage V sporulation protein E
GT119Model organism · annotation ≥ 4Fold GT-CInverting
External resources
Identification and annotation
| CAZy family | GT119 · CAZy entry |
| Gene symbol | spoVE |
| Synonyms / alternate names | not curated |
| UniProt accession | P07373 |
| NCBI Gene ID | 936953 |
| Source species | Bacillus subtilis (strain 168) |
| Taxonomic domain | Bacteria |
| UniProt annotation level | 4 |
Function and localisation
| Enzyme function | Stage V sporulation protein E |
| Subcellular location | not curated |
Structure and mechanism
| Fold type | GT-C |
| Catalytic mechanism | Inverting |
| Cation dependence | No |
| Oligomeric state | not curated |
| PDB structures | not curated |
Donor and acceptor specificity
| Sugar nucleotide donor | not curated |
| Donor CCD code(s) | not curated |
| Acceptor substrate(s) | not curated |
| Acceptor CCD / GlycoCT | not curated |
Protein sequences
Full protein sequence
366 aa
MTTKKTSPDLLLVIITLLLLTIGLIMVYSASAVWADYKFDDSFFFAKRQLLFAGIGVIAMFFIMNVDYWTWRTWSKLLMVICFFLLVLVLIPGVGMVRNGSRSWIGVGAFSIQPSEFMKLAMIAFLAKFLSEKQKNITSFRRGFVPALGIVFSAFLIIMCQPDLGTGTVMVGTCIVMIFVAGARIAHFVFLGLIGLSGFVGLVLSAPYRIKRITSYLNPWEDPLGSGFQIIQSLYAVGPGGLFGMGLGQSRQKFFYLPEPQTDFIFAILSEELGFIGGTLILLLFSVLLWRGIRIALGAPDLYGSFVAVGIISMIAIQVMINIGVVTGLIPVTGITLPFLSYGGSSLTLMLMAVGVLLNVSRYSRY
Catalytic domain sequence
355 aa
LLVIITLLLLTIGLIMVYSASAVWADYKFDDSFFFAKRQLLFAGIGVIAMFFIMNVDYWTWRTWSKLLMVICFFLLVLVLIPGVGMVRNGSRSWIGVGAFSIQPSEFMKLAMIAFLAKFLSEKQKNITSFRRGFVPALGIVFSAFLIIMCQPDLGTGTVMVGTCIVMIFVAGARIAHFVFLGLIGLSGFVGLVLSAPYRIKRITSYLNPWEDPLGSGFQIIQSLYAVGPGGLFGMGLGQSRQKFFYLPEPQTDFIFAILSEELGFIGGTLILLLFSVLLWRGIRIALGAPDLYGSFVAVGIISMIAIQVMINIGVVTGLIPVTGITLPFLSYGGSSLTLMLMAVGVLLNVSRYSR