GT-CORE (public beta v1)

Glycosyltransferase Curated Online Resource for Enzymology

Family-organised sequence, structure, mechanism and substrate-specificity records for the CAZy glycosyltransferases

wzy

Escherichia coli · O-antigen polymerase

GT123Model organism · annotation ≥ 4Fold GT-CInvertingannotation < 4

External resources

Identification and annotation

CAZy familyGT123 · CAZy entry
Gene symbolwzy
Synonyms / alternate namesnot curated
UniProt accessionAIG62402.1
NCBI Gene IDnot curated
Source speciesEscherichia coli
Taxonomic domainBacteria
UniProt annotation levelCorrect this entry below level 4

Function and localisation

Enzyme functionO-antigen polymerase
Subcellular locationnot curated

Structure and mechanism

Fold typeGT-C
Catalytic mechanismInverting
Cation dependencenot curated
Oligomeric statenot curated
PDB structuresnot curated

Donor and acceptor specificity

Sugar nucleotide donornot curated
Donor CCD code(s)not curated
Acceptor substrate(s)not curated
Acceptor CCD / GlycoCTnot curated

Protein sequences

Full protein sequence

434 aa
MGFIKVFNLKNSIVDDRYNLLWLFAGLLVVFVLGVLLFPLAGFFLFFFVAFLIANSSKFKLKRMVFFVLYFMLVMCIIINENSIQRFIYREDDFTTYYNNYLELLNGNYEFLFQFGGGAEIGLPALNYIFSFFIGNPFPYFLQMTYIGMYIVMLYYLVSIDRYFGNRDKSNKLDLLLWATLFLKITAMLTIERQAVASFFILYAISDIRRKYLWLFIGCLFHLSTPVVYLAVRFVLNTKTNKKVLVSCIALILFVVFSHQLLSVINHILPNDKVGYVLYYINNGDFIKNELVKSIKQVSYVIPLLLLDFAMRLQGYRWKLSSSLQLFVYSMLILSFLPGVPTRIFMPIVFILYGFYYYDFICLFRIKTRVIIFLIITSFFSVYKFFLPGYYYRYPIANIYPGYYISSFFDKYGYVERYSLPYSSDININNDDKL

Catalytic domain sequence

not curated