Home/GT Families/GT131/wbbH
wbbH
Escherichia coli (strain K12) · Putative O-antigen polymerase
GT131Model organism · annotation ≥ 4Fold GT-CRetaining (inferred)annotation < 4
External resources
Identification and annotation
| CAZy family | GT131 · CAZy entry |
|---|
| Gene symbol | wbbH |
|---|
| Synonyms / alternate names | |
|---|
| UniProt accession | P37748 |
|---|
| NCBI Gene ID | 945179 |
|---|
| Source species | Escherichia coli (strain K12) |
|---|
| Taxonomic domain | Bacteria |
|---|
| UniProt annotation level | 2 below level 4 |
|---|
Function and localisation
| Enzyme function | Putative O-antigen polymerase |
|---|
| Subcellular location | not curated |
|---|
Structure and mechanism
| Fold type | GT-C |
|---|
| Catalytic mechanism | Retaining (inferred) |
|---|
| Cation dependence | No |
|---|
| Oligomeric state | not curated |
|---|
| PDB structures | not curated |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | not curated |
|---|
| Donor CCD code(s) | not curated |
|---|
| Acceptor substrate(s) | not curated |
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
388 aa
MIYLVISVFLITAFICLYLKKDIFYPAVCVNIIFALVLLGYEITSDIYAFQLNDATLIFLLCNVLTFTLSCLLTESVLDLNIRKVNNAIYSIPSKKVHNVGLLVISFSMIYICMRLSNYQFGTSLLSYMNLIRDADVEDTSRNFSAYMQPIILTTFALFIWSKKFTNTKVSKTFTLLVFIVFIFAIILNTGKQIVFMVIISYAFIVGVNRVKHYVYLITAVGVLFSLYMLFLRGLPGGMAYYLSMYLVSPIIAFQEFYFQQVSNSASSHVFWFFERLMGLLTGGVSMSLHKEFVWVGLPTNVYTAFSDYVYISAELSYLMMVIHGCISGVLWRLSRNYISVKIFYSYFIYTFSFIFYHESFMTNISSWIQITLCIIVFSQFLKAQKIK
Catalytic domain sequence
not curated
