Home/GT Families/GT132/wzy
wzy
Escherichia coli · Wzy
GT132Model organism · annotation ≥ 4Fold GT-CRetaining (inferred)annotation < 4
External resources
Identification and annotation
| CAZy family | GT132 · CAZy entry |
|---|
| Gene symbol | wzy |
|---|
| Synonyms / alternate names | not curated |
|---|
| UniProt accession | D7PFC5 |
|---|
| NCBI Gene ID | not curated |
|---|
| Source species | Escherichia coli |
|---|
| Taxonomic domain | Bacteria |
|---|
| UniProt annotation level | 1 below level 4 |
|---|
Function and localisation
| Enzyme function | Wzy |
|---|
| Subcellular location | not curated |
|---|
Structure and mechanism
| Fold type | GT-C |
|---|
| Catalytic mechanism | Retaining (inferred) |
|---|
| Cation dependence | No |
|---|
| Oligomeric state | not curated |
|---|
| PDB structures | not curated |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | not curated |
|---|
| Donor CCD code(s) | not curated |
|---|
| Acceptor substrate(s) | not curated |
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
429 aa
MEYTIIIIFFVLLYFTSKVTWPFSGKNAHPINFVLFTQIFILTLPGVLILTFFKECAGSITCEIIAENIKINVMLDYFTVLCFILLGVLSSFFLLKGKTDFRPASNAHRRYLNTCFILTLLIFLVKIISVNQVPLFLTLLGHKDAAEIQKAEILRGEDGFSFPVINFLIKYFPLYFYYSTLIGLFKRKVTIVYFVMAFLVTSVTMLYDLQKGPVVIMIIGSFWLYWAYTGKAKMIVVGGIFSLFLVGVLFYISFDFGDDTQYFITAVLNRTFIAQNDGMYWVYQYYNILPNKELYSLWGVPLAQQFGIPQIDPLSDIIGVVFPQAKDSWVNTTTFLLGEAKAIFGDYSSIISSLVVFINVFVVCVLSTLLVRVSKNIFYPAIFVMIQTIPFANNLTDLLYGRFIFGFLVFMLFPVLICFLCYGKLKNDE
Catalytic domain sequence
not curated
