Home/GT Families/GT138/avrXccC
avrXccC
Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) · Avirulence protein
GT138Lower annotation levelFold Orthogonal helix bundleInvertingannotation < 4
External resources
Identification and annotation
| CAZy family | GT138 · CAZy entry |
|---|
| Gene symbol | avrXccC |
|---|
| Synonyms / alternate names | not curated |
|---|
| UniProt accession | Q8P8X2 |
|---|
| NCBI Gene ID | not curated |
|---|
| Source species | Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) |
|---|
| Taxonomic domain | Bacteria |
|---|
| UniProt annotation level | 1 below level 4 |
|---|
Function and localisation
| Enzyme function | Avirulence protein |
|---|
| Subcellular location | not curated |
|---|
Structure and mechanism
| Fold type | Orthogonal helix bundle |
|---|
| Catalytic mechanism | Inverting |
|---|
| Cation dependence | No |
|---|
| Oligomeric state | not curated |
|---|
| PDB structures | not curated |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | not curated |
|---|
| Donor CCD code(s) | not curated |
|---|
| Acceptor substrate(s) | not curated |
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
331 aa
MWSQPVWNPYASFDTGTASSHSQAVQGTATNYLRGPANYSKLSSEEQSLVGAARWPDDAPGLNISNKSNTQDNKKYCKSLYKASRIAGGSIASGQINSFNDLWQKATQWRLSRISSGDASKGDFAAERMPNTRFVTSLRRPYHSVIERARNHPDAETELYEGEYFKEIEVKVYRQCGAISGETIPMTTVSAAVDDNAISARLRNLPKDKRQQARQSMASSHPNMITHTSAEYIKTIRDHLESLYLQAIDPSLEKHEAFELIARLHWWAASAAPDKRGSAAKAEFAARSIASAHGIEMPPFRHGIVPDIEAMLRSESQFVADYPNFFERPPI
Catalytic domain sequence
322 aa
NPYASFDTGTASSHSQAVQGTATNYLRGPANYSKLSSEEQSLVGAARWPDDAPGLNISNKSNTQDNKKYCKSLYKASRIAGGSIASGQINSFNDLWQKATQWRLSRISSGDASKGDFAAERMPNTRFVTSLRRPYHSVIERARNHPDAETELYEGEYFKEIEVKVYRQCGAISGETIPMTTVSAAVDDNAISARLRNLPKDKRQQARQSMASSHPNMITHTSAEYIKTIRDHLESLYLQAIDPSLEKHEAFELIARLHWWAASAAPDKRGSAAKAEFAARSIASAHGIEMPPFRHGIVPDIEAMLRSESQFVADYPNFFERP
