Home/GT Families/GT14/GCNT1
GCNT1
Bos taurus · Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase (EC 2.4.1.102)
GT14Non-model organism · annotation 4–5Fold GT-AInverting
External resources
Identification and annotation
| CAZy family | GT14 · CAZy entry |
| Gene symbol | GCNT1 |
| Synonyms / alternate names | - Core 2 beta-1,6-N-acetylglucosaminyltransferase
- Core 2-branching enzyme
- Core2-GlcNAc-transferase
- Leukocyte type core 2 beta-1,6-N-acetylglucosaminyltransferase
|
| UniProt accession | Q92180 |
| NCBI Gene ID | not curated |
| Source species | Bos taurus |
| Taxonomic domain | Eukaryota |
| UniProt annotation level | 5 |
Function and localisation
| Enzyme function | Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase (EC 2.4.1.102) |
| Subcellular location | Golgi apparatus membrane |
Structure and mechanism
| Fold type | GT-A |
| Catalytic mechanism | Inverting |
| Cation dependence | No |
| Oligomeric state | Interacts with GOLPH3; may control GCNT1 retention in the Go |
| PDB structures | not curated |
Donor and acceptor specificity
| Sugar nucleotide donor | UDP-N-acetyl-alpha-D-glucosamine |
| Donor CCD code(s) | UD1 |
| Acceptor substrate(s) | - a 3-O-[beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl]-L-seryl-[protein]
- a 3-O-[beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl]-L-threonyl-[protein]
- a globoside GalGb4Cer
- a ganglioside GA1
|
| Acceptor CCD / GlycoCT | not curated |
Protein sequences
Full protein sequence
427 aa
MLRKLWRRKLFSFPTKYYFLFLAFSVVTFTVLRIHQKTEFVNFGHLELFEENPSSNINCTKILQGDVDEIQKVKLESLTVKFKKRARWTNYDYINMTGDCASFIKKRKYITEPLSKEEAGFPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDAKSEKSFLAAAVGIASCFSNVFVASQLESVVYASWSRVQADLNCMQDLYQMNAGWKYLINLCGMDFPIKTNLEIVRKLKLLMGENNLETEKMPSHKKERWKKHYEVVNGKLTNMGTDKIHPPLETPLFSGSAHFVVSREYVEYVLQNQNIQKFMEWAKDTYSPDEYLWATIQRIPEVPGSLSLSYKYDTSDMQAIARFVKWQYFEGDVSKGAPYPPCSVHVRSVCVFGAGDLNWLLHVHHLFANKFDTDIDLFAIQCLDEHLRHKALETLKP
Catalytic domain sequence
268 aa
IAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDAKSEKSFLAAAVGIASCFSNVFVASQLESVVYASWSRVQADLNCMQDLYQMNAGWKYLINLCGMDFPIKTNLEIVRKLKLLMGENNLETEKMPSHKKERWKKHYEVVNGKLTNMGTDKIHPPLETPLFSGSAHFVVSREYVEYVLQNQNIQKFMEWAKDTYSPDEYLWATIQRIPEVPGSLSLSYKYDTSDMQAIARFVKWQYFEGDVSKGAPYPPCSVHVRSVCVFGAGDLNWL