GT-CORE (public beta v1)

Glycosyltransferase Curated Online Resource for Enzymology

Family-organised sequence, structure, mechanism and substrate-specificity records for the CAZy glycosyltransferases

tagA

Bacillus subtilis (strain 168) · N-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase (EC 2.4.1.187)

GT26Model organism · annotation ≥ 4Fold NovelInverting

External resources

Identification and annotation

CAZy familyGT26 · CAZy entry
Gene symboltagA
Synonyms / alternate names
  • Major teichoic acid biosynthesis protein A
  • N-acetylmannosaminyltransferase
  • UDP-N-acetylmannosamine transferase
  • UDP-N-acetylmannosamine:N-acetylglucosaminyl pyrophosphorylundecaprenol N-acetylmannosaminyltransferase
UniProt accessionP27620
NCBI Gene ID936810
Source speciesBacillus subtilis (strain 168)
Taxonomic domainBacteria
UniProt annotation level4

Function and localisation

Enzyme functionN-acetylglucosaminyldiphosphoundecaprenol N-acetyl-beta-D-mannosaminyltransferase (EC 2.4.1.187)
Subcellular locationnot curated

Structure and mechanism

Fold typeNovel
Catalytic mechanismInverting
Cation dependenceNo
Oligomeric statenot curated
PDB structuresnot curated

Donor and acceptor specificity

Sugar nucleotide donorUDP-N-acetyl-alpha-D-mannosamine
Donor CCD code(s)UD9
Acceptor substrate(s)
  • N-acetyl-alpha-D-glucosaminyl-di-trans
  • octa-cis-undecaprenyl diphosphate
Acceptor CCD / GlycoCTnot curated

Protein sequences

Full protein sequence

256 aa
MQTETIHNIPYVNSNLTSFIDYLEKHYIDQKIGAVISTVNPEIAFAAIKDRDYFDVLSSSNFILPDGIGVVMMSRLTNNRLQSRIAGYDVFKELLGVANKKKKRIFLYGAKKDVIKGVVSKISSEYPNIKIAGYSDGYVQDRTLVAKQIARANPDMVFVALGYPHQEKFIHNYRHLFPKAVSIGLGGSFDVFSGNVKRAPSWMIRLNLEWFYRLILNPWRWKRMLSIPKYALTVLKEEKNKKTFYPKPEKDHTKQI

Catalytic domain sequence

168 aa
LSSSNFILPDGIGVVMMSRLTNNRLQSRIAGYDVFKELLGVANKKKKRIFLYGAKKDVIKGVVSKISSEYPNIKIAGYSDGYVQDRTLVAKQIARANPDMVFVALGYPHQEKFIHNYRHLFPKAVSIGLGGSFDVFSGNVKRAPSWMIRLNLEWFYRLILNPWRWKRM