Home/GT Families/GT27/GALNTL5
GALNTL5
Homo sapiens · Inactive polypeptide N-acetylgalactosaminyltransferase-like protein 5
GT27Model organism · annotation ≥ 4Fold GT-ARetaining
External resources
Identification and annotation
| CAZy family | GT27 · CAZy entry |
|---|
| Gene symbol | GALNTL5 |
|---|
| Synonyms / alternate names | - GALNT15
- Polypeptide GalNAc transferase 15
- Protein-UDP acetylgalactosaminyltransferase 15
- UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 15
|
|---|
| UniProt accession | Q7Z4T8 |
|---|
| NCBI Gene ID | 168391 |
|---|
| Source species | Homo sapiens |
|---|
| Taxonomic domain | Eukaryota |
|---|
| UniProt annotation level | 5 |
|---|
Function and localisation
| Enzyme function | Inactive polypeptide N-acetylgalactosaminyltransferase-like protein 5 |
|---|
| Subcellular location | Late endosome membrane |
|---|
Structure and mechanism
| Fold type | GT-A |
|---|
| Catalytic mechanism | Retaining |
|---|
| Cation dependence | Yes (Mn2+) |
|---|
| Oligomeric state | not curated |
|---|
| PDB structures | not curated |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | not curated |
|---|
| Donor CCD code(s) | not curated |
|---|
| Acceptor substrate(s) | not curated |
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
443 aa
MRNAIIQGLFYGSLTFGIWTALLFIYLHHNHVSSWQKKSQEPLSAWSPGKKVHQQIIYGSEQIPKPHVIVKRTDEDKAKSMLGTDFNHTNPELHKELLKYGFNVIISRSLGIEREVPDTRSKMCLQKHYPARLPTASIVICFYNEECNALFQTMSSVTNLTPHYFLEEIILVDDMSKVDDLKEKLDYHLETFRGKVKIIRNKKREGLIRARLIGASHASGDVLVFLDSHCEVNRVWLEPLLHAIAKDPKMVVCPLIDVIDDRTLEYKPSPLVRGTFDWNLQFKWDNVFSYEMDGPEGSTKPIRSPAMSGGIFAIRRHYFNEIGQYDKDMDFWGRENLELSLRIWMCGGQLFIIPCSRVGHISKKQTGKPSTIISAMTHNYLRLVHVWLDEYKEQFFLRKPGLKYVTYGNIRERVELRKRLGCKSFQWYLDNVFPELEASVNSL
Catalytic domain sequence
181 aa
SIVICFYNEECNALFQTMSSVTNLTPHYFLEEIILVDDMSKVDDLKEKLDYHLETFRGKVKIIRNKKREGLIRARLIGASHASGDVLVFLDSHCEVNRVWLEPLLHAIAKDPKMVVCPLIDVIDDRTLEYKPSPLVRGTFDWNLQFKWDNVFSYEMDGPEGSTKPIRSPAMSGGIFAIRRH
