Home/GT Families/GT29/SIA2
SIA2
Arabidopsis thaliana · Sialyltransferase-like protein 2 (EC 2.4.-.-)
GT29Model organism · annotation ≥ 4Fold GT-AInverting
External resources
Identification and annotation
| CAZy family | GT29 · CAZy entry |
|---|
| Gene symbol | SIA2 |
|---|
| Synonyms / alternate names | not curated |
|---|
| UniProt accession | Q8RY00 |
|---|
| NCBI Gene ID | 824043 |
|---|
| Source species | Arabidopsis thaliana |
|---|
| Taxonomic domain | Eukaryota |
|---|
| UniProt annotation level | 5 |
|---|
Function and localisation
| Enzyme function | Sialyltransferase-like protein 2 (EC 2.4.-.-) |
|---|
| Subcellular location | Golgi apparatus membrane |
|---|
Structure and mechanism
| Fold type | GT-A |
|---|
| Catalytic mechanism | Inverting |
|---|
| Cation dependence | No |
|---|
| Oligomeric state | not curated |
|---|
| PDB structures | not curated |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | not curated |
|---|
| Donor CCD code(s) | not curated |
|---|
| Acceptor substrate(s) | not curated |
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
440 aa
MKLLHLIFLLALTTGISAVLIYIIGVSNLYESNRFTNEDLEALQSLQNGFQKCVSANGLGLQAAMGRDYCKVSINFPKDTVPKWKDPKSGELEGLSYEFDLCEAVATWEQVRNSSTILTKEYIDALPNGWEDYAWRRINKGIQLNRCQNKSLCIEKLSLVLPETPPYFPRQFGRCAVIGNSGDLLKTKFGKEIDTYDTVLRENGAPIQNYKEYVGEKSTFRLLNRGSAKALDKVVELDEKKQEVLLVKTTIHDIMNKMIREVPIKNPVYLMLGASFGSAAKGTGLKALEFALSTCDSVDMYGFTVDPGYKEWTRYFSESRQGHTPLHGRAYYQMMECLGLIKIHSPMRADPNRVVKWVPSRSTIRSARIAAEKLLRRVGAGSADPLASCSIVKKRNKNKRPMVSHLRKPVSDHQKFVRSTSMYPVEHSPGHGQLCITPAD
Catalytic domain sequence
102 aa
KLSLVLPETPPYFPRQFGRCAVIGNSGDLLKTKFGKEIDTYDTVLRENGAPIQNYKEYVGEKSTFRLLNRGSAKALDKVVELDEKKQEVLLVKTTIHDIMNK
