GT-CORE (public beta v1)

Glycosyltransferase Curated Online Resource for Enzymology

Family-organised sequence, structure, mechanism and substrate-specificity records for the CAZy glycosyltransferases

ST3GAL3

Pan troglodytes · CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase (EC 2.4.3.6)

GT29Non-model organism · annotation 4–5Fold GT-AInverting

External resources

Identification and annotation

CAZy familyGT29 · CAZy entry
Gene symbolST3GAL3
Synonyms / alternate names
  • SIAT6
  • Beta-galactoside alpha-2,3-sialyltransferase 3
  • Gal beta-1,3(4) GlcNAc alpha-2,3 sialyltransferase
  • N-acetyllactosaminide alpha-2,3-sialyltransferase
  • ST3Gal III
  • ST3N
  • Sialyltransferase 6
UniProt accessionP61132
NCBI Gene ID456832
Source speciesPan troglodytes
Taxonomic domainEukaryota
UniProt annotation level4

Function and localisation

Enzyme functionCMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase (EC 2.4.3.6)
Subcellular location
  • Golgi apparatus, Golgi stack membrane
  • Secreted

Structure and mechanism

Fold typeGT-A
Catalytic mechanismInverting
Cation dependenceNo
Oligomeric statenot curated
PDB structuresnot curated

Donor and acceptor specificity

Sugar nucleotide donorCMP-N-acetyl-beta-neuraminate
Donor CCD code(s)NCC
Acceptor substrate(s)a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative
Acceptor CCD / GlycoCTnot curated

Protein sequences

Full protein sequence

375 aa
MGLLVFVRNLLLALCLFLVLGFLYYSAWKLHLLQWEEDSNSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAELATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLRCRRCIIVGNGGVLANKSLGSRIDDYDIVVRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI

Catalytic domain sequence

253 aa
FRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLRCRRCIIVGNGGVLANKSLGSRIDDYDIVVRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKAR