GT-CORE (public beta v1)

Glycosyltransferase Curated Online Resource for Enzymology

Family-organised sequence, structure, mechanism and substrate-specificity records for the CAZy glycosyltransferases

ST8SIA6

Pan troglodytes · Alpha-2,8-sialyltransferase 8F (EC 2.4.99.-)

GT29Non-model organism · annotation 4–5Fold GT-AInverting

External resources

Identification and annotation

CAZy familyGT29 · CAZy entry
Gene symbolST8SIA6
Synonyms / alternate names
  • SIAT8F
  • Sialyltransferase 8F
  • Sialyltransferase St8Sia VI
UniProt accessionP61648
NCBI Gene ID450329
Source speciesPan troglodytes
Taxonomic domainEukaryota
UniProt annotation level5

Function and localisation

Enzyme functionAlpha-2,8-sialyltransferase 8F (EC 2.4.99.-)
Subcellular locationGolgi apparatus membrane

Structure and mechanism

Fold typeGT-A
Catalytic mechanismInverting
Cation dependenceNo
Oligomeric statenot curated
PDB structuresnot curated

Donor and acceptor specificity

Sugar nucleotide donorCMP-N-acetyl-beta-neuraminate
Donor CCD code(s)NCC
Acceptor substrate(s)
  • a ganglioside GM3
  • a ganglioside GM3 (d18:1(4E))
  • a ganglioside GD1a (d18:1(4E))
  • a ganglioside GD1a
  • a ganglioside GM1b (d18:1(4E))
  • a ganglioside GM1b
  • a ganglioside GM4 (d18:1(4E))
  • N-acetyl-alpha-neuraminosyl-(2->3)-beta-D-galactosyl-(1<->1')-ceramide
  • a ganglioside GT1b (d18:1(4E))
  • a ganglioside GT1b
Acceptor CCD / GlycoCTnot curated

Protein sequences

Full protein sequence

398 aa
MRPGGALLALLASLLLLLLLRLLWCPADAPGRARILVEESREATHGTPAALRTLRSPATAVPRATNSTYLNEKSLHLTEKCKNLQYGIESFSNKTKGYSENDYLQIITDIQSCPWKRQAEEYANFRAKLASCCDAVQNFVVSQNNTPVGTNMSYEVESKKEIPIKKNIFHMFPVSQPFVDYPYNQCAVVGNGGILNKSLCGTEIDKSDFVFRCNLPPTTGDVSKDVGSKTNLVTINPSIITLKYGNLKEKKALFLEDIATYGEAFFLLPAFSFRANTGTSFKVYYTLEESKARQKVLFFHPKYLKDLALFWRTKGVTAYRLSTGLMITSVAVELCKNVKLYGFWPFSKTVEDIPVSHHYYDNKLPKHGFHQMPKEYSQILQLHMKGILKLQFSKCEVA

Catalytic domain sequence

273 aa
EEYANFRAKLASCCDAVQNFVVSQNNTPVGTNMSYEVESKKEIPIKKNIFHMFPVSQPFVDYPYNQCAVVGNGGILNKSLCGTEIDKSDFVFRCNLPPTTGDVSKDVGSKTNLVTINPSIITLKYGNLKEKKALFLEDIATYGEAFFLLPAFSFRANTGTSFKVYYTLEESKARQKVLFFHPKYLKDLALFWRTKGVTAYRLSTGLMITSVAVELCKNVKLYGFWPFSKTVEDIPVSHHYYDNKLPKHGFHQMPKEYSQILQLHMKGILKLQF