GT-CORE (public beta v1)

Glycosyltransferase Curated Online Resource for Enzymology

Family-organised sequence, structure, mechanism and substrate-specificity records for the CAZy glycosyltransferases

St8sia2

Rattus norvegicus · Alpha-2,8-sialyltransferase 8B (EC 2.4.3.-)

GT29Non-model organism · annotation 4–5Fold GT-AInverting

External resources

Identification and annotation

CAZy familyGT29 · CAZy entry
Gene symbolSt8sia2
Synonyms / alternate names
  • Siat8b
  • Stx
  • Sialyltransferase 8B
  • Sialyltransferase St8Sia II
  • Sialyltransferase X
UniProt accessionQ07977
NCBI Gene ID117523
Source speciesRattus norvegicus
Taxonomic domainEukaryota
UniProt annotation level5

Function and localisation

Enzyme functionAlpha-2,8-sialyltransferase 8B (EC 2.4.3.-)
Subcellular location
  • Golgi apparatus membrane
  • Secreted
  • Cell membrane

Structure and mechanism

Fold typeGT-A
Catalytic mechanismInverting
Cation dependenceNo
Oligomeric statenot curated
PDB structuresnot curated

Donor and acceptor specificity

Sugar nucleotide donorCMP-N-acetyl-beta-neuraminate
Donor CCD code(s)NCC
Acceptor substrate(s)[N-acetyl-alpha-D-neuraminosyl-(2->8)](n)
Acceptor CCD / GlycoCTnot curated

Protein sequences

Full protein sequence

375 aa
MQLQFRSWMLAALTLLVVFLIFADISEIEEEIGNSGGRGTIRSAVNSLHSKSNRAEVVINGSSLPAVADRSNESLKHSIQPASSKWRHNQTLSLRIRKQILKFLDAEKDISVLKGTLKPGDIIHYIFDRDSTMNVSQNLYELLPRTSPLKNKHFQTCAIVGNSGVLLNSGCGQEIDTHSFVIRCNLAPVQEYARDVGLKTDLVTMNPSVIQRAFEDLVNATWREKLLQRLHGLNGSILWIPAFMARGGKERVEWVNALILKHHVNVRTAYPSLRLLHAVRGYWLTNKVHIKRPTTGLLMYTLATRFCNQIYLYGFWPFPLDQNQNPVKYHYYDSLKYGYTSQASPHTMPLEFKALKSLHEQGALKLTVGQCDGAT

Catalytic domain sequence

278 aa
TLSLRIRKQILKFLDAEKDISVLKGTLKPGDIIHYIFDRDSTMNVSQNLYELLPRTSPLKNKHFQTCAIVGNSGVLLNSGCGQEIDTHSFVIRCNLAPVQEYARDVGLKTDLVTMNPSVIQRAFEDLVNATWREKLLQRLHGLNGSILWIPAFMARGGKERVEWVNALILKHHVNVRTAYPSLRLLHAVRGYWLTNKVHIKRPTTGLLMYTLATRFCNQIYLYGFWPFPLDQNQNPVKYHYYDSLKYGYTSQASPHTMPLEFKALKSLHEQGALKLTV