Home/GT Families/GT32/A4galt
A4galt
Rattus norvegicus · Lactosylceramide 4-alpha-galactosyltransferase (EC 2.4.1.228)
GT32Non-model organism · annotation 4–5Fold GT-ARetaining
External resources
Identification and annotation
| CAZy family | GT32 · CAZy entry |
| Gene symbol | A4galt |
| Synonyms / alternate names | - Alpha-1,4-N-acetylglucosaminyltransferase
- Alpha-1,4-galactosyltransferase
- Alpha4Gal-T1
- Globotriaosylceramide synthase
- UDP-galactose:beta-D-galactosyl-beta1-R 4-alpha-D-galactosyltransferase
|
| UniProt accession | Q9JI93 |
| NCBI Gene ID | 63888 |
| Source species | Rattus norvegicus |
| Taxonomic domain | Eukaryota |
| UniProt annotation level | 5 |
Function and localisation
| Enzyme function | Lactosylceramide 4-alpha-galactosyltransferase (EC 2.4.1.228) |
| Subcellular location | Golgi apparatus membrane |
Structure and mechanism
| Fold type | GT-A |
| Catalytic mechanism | Retaining |
| Cation dependence | Yes (Mn2+) |
| Oligomeric state | not curated |
| PDB structures | not curated |
Donor and acceptor specificity
| Sugar nucleotide donor | UDP-alpha-D-galactose |
| Donor CCD code(s) | GDU |
| Acceptor substrate(s) | - a beta-D-Gal-(1->4)-beta-D-Glc-(1<->1)-Cer(d18:1(4E))
- a beta-D-Gal-(1<->1')-ceramide
|
| Acceptor CCD / GlycoCT | not curated |
Protein sequences
Full protein sequence
360 aa
MGISRSDLEETMSKPPDCLPRMLRGTPRQRVFTLFIISFKFTFLVSILIYWHTVGAPKDQRRQYSLPVDFPCPQLAFPRVSAPGNIFFLETSDRTNPSFLFMCSVESAARAHPESQVVVLMKGLPRDTTAWPRNLGISLLSCFPNVQIRPLDLQELFEDTPLAAWYLEAQHRWEPYLLPVLSDASRIALLWKFGGIYLDTDFIVLKNLRNLTNMLGIQSRYVLNGAFLAFERKHEFLALCIRDFVAHYNGWIWGHQGPQLLTRVFKKWCSIHSLKESRACRGVTALPPEAFYPIPWQNWKKYFEDVSPEELAQLLNATYAVHVWNKKSQGTHLEATSRALLAQLHARYCPTTHRAMTMYL
Catalytic domain sequence
127 aa
AFERKHEFLALCIRDFVAHYNGWIWGHQGPQLLTRVFKKWCSIHSLKESRACRGVTALPPEAFYPIPWQNWKKYFEDVSPEELAQLLNATYAVHVWNKKSQGTHLEATSRALLAQLHARYCPTTHRA