GT-CORE (public beta v1)

Glycosyltransferase Curated Online Resource for Enzymology

Family-organised sequence, structure, mechanism and substrate-specificity records for the CAZy glycosyltransferases

OCH1

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) · Initiation-specific alpha-1,6-mannosyltransferase (EC 2.4.1.232)

GT32Model organism · annotation ≥ 4Fold GT-ARetaining1 PDB structure(s)

External resources

Identification and annotation

CAZy familyGT32 · CAZy entry
Gene symbolOCH1
Synonyms / alternate names
  • NGD29
  • Outer chain elongation protein 1
UniProt accessionP31755
NCBI Gene ID852845
Source speciesSaccharomyces cerevisiae (strain ATCC 204508 / S288c)
Taxonomic domainEukaryota
UniProt annotation level5

Function and localisation

Enzyme functionInitiation-specific alpha-1,6-mannosyltransferase (EC 2.4.1.232)
Subcellular location
  • Endoplasmic reticulum membrane
  • Golgi apparatus membrane

Structure and mechanism

Fold typeGT-A
Catalytic mechanismRetaining
Cation dependenceYes (Mn2+)
Oligomeric statenot curated
PDB structures9N3S

Donor and acceptor specificity

Sugar nucleotide donornot curated
Donor CCD code(s)not curated
Acceptor substrate(s)not curated
Acceptor CCD / GlycoCTnot curated

Protein sequences

Full protein sequence

480 aa
MSRKLSHLIATRKSKTIVVTVLLIYSLLTFHLSNKRLLSQFYPSKDDFKQTLLPTTSHSQDINLKKQITVNKKKNQLHNLRDQLSFAFPYDSQAPIPQRVWQTWKVGADDKNFPSSFRTYQKTWSGSYSPDYQYSLISDDSIIPFLENLYAPVPIVIQAFKLMPGNILKADFLRYLLLFARGGIYSDMDTMLLKPIDSWPSQNKSWLNNIIDLNKPIPYKNSKPSLLSSDEISHQPGLVIGIEADPDRDDWSEWYARRIQFCQWTIQAKPGHPILRELILNITATTLASVQNPGVPVSEMIDPRFEEDYNVNYRHKRRHDETYKHSELKNNKNVDGSDIMNWTGPGIFSDIIFEYMNNVLRYNSDILLINPNLNKNDEEGSESATTPAKDVDNDTLSKSTRKFYKKISESLQSSNSMPWEFFSFLKEPVIVDDVMVLPITSFSPDVGQMGAQSSDDKMAFVKHMFSGSWKEDADKNAGHK

Catalytic domain sequence

93 aa
PSSFRTYQKTWSGSYSPDYQYSLISDDSIIPFLENLYAPVPIVIQAFKLMPGNILKADFLRYLLLFARGGIYSDMDTMLLKPIDSWPSQNKSW