Home/GT Families/GT32/OCH1
OCH1
Candida albicans (strain SC5314 / ATCC MYA-2876) · Initiation-specific alpha-1,6-mannosyltransferase (EC 2.4.1.232)
GT32Non-model organism · annotation 4–5Fold GT-ARetaining
External resources
Identification and annotation
| CAZy family | GT32 · CAZy entry |
|---|
| Gene symbol | OCH1 |
|---|
| Synonyms / alternate names | Outer chain elongation protein 1 |
|---|
| UniProt accession | Q5A4E3 |
|---|
| NCBI Gene ID | 3641751 |
|---|
| Source species | Candida albicans (strain SC5314 / ATCC MYA-2876) |
|---|
| Taxonomic domain | Eukaryota |
|---|
| UniProt annotation level | 5 |
|---|
Function and localisation
| Enzyme function | Initiation-specific alpha-1,6-mannosyltransferase (EC 2.4.1.232) |
|---|
| Subcellular location | - Endoplasmic reticulum membrane
- Golgi apparatus membrane
|
|---|
Structure and mechanism
| Fold type | GT-A |
|---|
| Catalytic mechanism | Retaining |
|---|
| Cation dependence | Yes (Mn2+) |
|---|
| Oligomeric state | not curated |
|---|
| PDB structures | not curated |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | not curated |
|---|
| Donor CCD code(s) | not curated |
|---|
| Acceptor substrate(s) | not curated |
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
385 aa
MLQLREPQMVHKHLKLAVLGIVVIFTTYFIISSLSSPTSTHKTEYNSPKLQLAKELELNSNWKELGLNFQPNKKYSLPDESTLRQQLSYQFPYDESKPFPKNIWQTWKVGIDEKSFPKRYLKYQQTWEDKNPDYKHYVVPDKQCDLLIEQLYSQVPDVAKAYRIMPKSILKADFFRYLILFARGGVYTDIDTVGLKPVDEWISNSEMILEKKNRSGLVVGIEADPDRPDWADWYARRIQFCQWTIQSKRGHPMLRELIAKITDITLTRHKKGQLKKVLGKNEGGDIMNWTGPGIFTDTVFEYMNNILQSPEVFKNKKKWATIIDWKLFTGMEQPIAIDDVLVLPITSFSPDVNQMGAKDSHDPMAYAKHMFSGSWKDDGMPEMEQ
Catalytic domain sequence
90 aa
PKRYLKYQQTWEDKNPDYKHYVVPDKQCDLLIEQLYSQVPDVAKAYRIMPKSILKADFFRYLILFARGGVYTDIDTVGLKPVDEWISNSE
