Home/GT Families/GT40/LPG1
LPG1
Leishmania major · Beta galactofuranosyl transferase
GT40Model organism · annotation ≥ 4Fold GT-AInvertingannotation < 4
External resources
Identification and annotation
| CAZy family | GT40 · CAZy entry |
|---|
| Gene symbol | LPG1 |
|---|
| Synonyms / alternate names | not curated |
|---|
| UniProt accession | Q9NC61 |
|---|
| NCBI Gene ID | 5652730 |
|---|
| Source species | Leishmania major |
|---|
| Taxonomic domain | Eukaryota |
|---|
| UniProt annotation level | 1 below level 4 |
|---|
Function and localisation
| Enzyme function | Beta galactofuranosyl transferase |
|---|
| Subcellular location | not curated |
|---|
Structure and mechanism
| Fold type | GT-A |
|---|
| Catalytic mechanism | Inverting |
|---|
| Cation dependence | No |
|---|
| Oligomeric state | not curated |
|---|
| PDB structures | not curated |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | not curated |
|---|
| Donor CCD code(s) | not curated |
|---|
| Acceptor substrate(s) | not curated |
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
434 aa
MAPRRWHHNCRRMASFVRIGLYTLLFLMGYIVPLIIFYNRSGTETFEDTPRPGERFISDENFFHCIAERLSYKDQHPARIPYVLIPVTMDYQDIKQLFCNITVPMTYIMFINNGMFRPLRSLLDRLAVELRDYVDQNLFIIHHPENIGYASAVNEGLRHALNFSVAQVPWIFITNADVRFAPGLMDEFVSQAHIRTQGQLERIRRLDEEIVAEIKTLKNVPDPRFAFRSSRHPIVTASSLPYRIRTMPPEQMKKQFADAYGIFFTDHKEFMATFALSRLAIATLGFFDENFYPAYGEDHDYMWRMNALGYRKYFSERGKYVHFQNANLNVGGSAKNRGVFKDTAYFVQNVKFWRMNNELFRLQYRHAKWFPDDVTIYRGVRRRPLPFNGTIPVDMWVLDAERQRSIWQIGESMRCHRDYKPYSTKLLDFAVDPS
Catalytic domain sequence
67 aa
DRLAVELRDYVDQNLFIIHHPENIGYASAVNEGLRHALNFSVAQVPWIFITNADVRFAPGLMDEFVS
