Home/GT Families/GT42/HI_0352
HI_0352
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) · Uncharacterized protein HI_0352
GT42Lower annotation levelFold GT-AInvertingannotation < 4
External resources
Identification and annotation
| CAZy family | GT42 · CAZy entry |
|---|
| Gene symbol | HI_0352 |
|---|
| Synonyms / alternate names | ORF1 |
|---|
| UniProt accession | P24324 |
|---|
| NCBI Gene ID | not curated |
|---|
| Source species | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
|---|
| Taxonomic domain | Bacteria |
|---|
| UniProt annotation level | 1 below level 4 |
|---|
Function and localisation
| Enzyme function | Uncharacterized protein HI_0352 |
|---|
| Subcellular location | not curated |
|---|
Structure and mechanism
| Fold type | GT-A |
|---|
| Catalytic mechanism | Inverting |
|---|
| Cation dependence | No |
|---|
| Oligomeric state | not curated |
|---|
| PDB structures | not curated |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | not curated |
|---|
| Donor CCD code(s) | not curated |
|---|
| Acceptor substrate(s) | not curated |
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
231 aa
MQLIKNNEYEYADIILSSFVNLGDSELKKIKNVQKLLTQVDIGHYYLNKLPAFDAYLQYNELYENKRITSGVYMCAVATVMGYKDLYLTGIDFYQEKGNPYAFHHQKENIIKLLPSFSQNKSQSDIHSMEYDLNALYFLQKHYGVNIYCISPESPLCNYFPLSPLNNPITFILEEKKNYTQDILIPPKFVYKKIGIYSKPRIYQNLIFRLIWDILRLPNDIKHALKSRKWD
Catalytic domain sequence
226 aa
QLIKNNEYEYADIILSSFVNLGDSELKKIKNVQKLLTQVDIGHYYLNKLPAFDAYLQYNELYENKRITSGVYMCAVATVMGYKDLYLTGIDFYQEKGNPYAFHHQKENIIKLLPSFSQNKSQSDIHSMEYDLNALYFLQKHYGVNIYCISPESPLCNYFPLSPLNNPITFILEEKKNYTQDILIPPKFVYKKIGIYSKPRIYQNLIFRLIWDILRLPNDIKHALKS
