Home/GT Families/GT45/KfiA
KfiA
Escherichia coli · KfiA protein
GT45Model organism · annotation ≥ 4Fold GT-ARetaining1 PDB structure(s)annotation < 4
External resources
Identification and annotation
| CAZy family | GT45 · CAZy entry |
|---|
| Gene symbol | KfiA |
|---|
| Synonyms / alternate names | kfiA |
|---|
| UniProt accession | Q47332 |
|---|
| NCBI Gene ID | not curated |
|---|
| Source species | Escherichia coli |
|---|
| Taxonomic domain | Bacteria |
|---|
| UniProt annotation level | 1 below level 4 |
|---|
Function and localisation
| Enzyme function | KfiA protein |
|---|
| Subcellular location | not curated |
|---|
Structure and mechanism
| Fold type | GT-A |
|---|
| Catalytic mechanism | Retaining |
|---|
| Cation dependence | No |
|---|
| Oligomeric state | not curated |
|---|
| PDB structures | 5Z8B |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | not curated |
|---|
| Donor CCD code(s) | not curated |
|---|
| Acceptor substrate(s) | not curated |
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
238 aa
MIVANMSSYPPRKKELVHSIQSLHAQVDKINLCLNEFEEIPEELDGFSKLNPVIPDKDYKDVGKFIFPCAKNDMIVLTDDDIIYPPDYVEKMLNFYNSFAIFNCIVGIHGCIYIDAFDGDQSKRKVFSFTQGLLRPRVVNQLGTGTVFLKADQLPSLKYMDGSQRFVDVRFSRYMLENEIGMICVPREKNWLREVSSGSMEGLWNTFTKKWPLDIIKETQAIAGYSKLNLELVYNVEG
Catalytic domain sequence
166 aa
NEFEEIPEELDGFSKLNPVIPDKDYKDVGKFIFPCAKNDMIVLTDDDIIYPPDYVEKMLNFYNSFAIFNCIVGIHGCIYIDAFDGDQSKRKVFSFTQGLLRPRVVNQLGTGTVFLKADQLPSLKYMDGSQRFVDVRFSRYMLENEIGMICVPREKNWLREVSSGSM
