Home/GT Families/GT51/mtgA
mtgA
Escherichia coli (strain K12) · Biosynthetic peptidoglycan transglycosylase (EC 2.4.99.28)
GT51Model organism · annotation ≥ 4Fold Lysozyme-typeInverting
External resources
Identification and annotation
| CAZy family | GT51 · CAZy entry |
|---|
| Gene symbol | mtgA |
|---|
| Synonyms / alternate names | - mgt
- yrbM
- Glycan polymerase
- Monofunctional biosynthetic peptidoglycan transglycosylase
- Monofunctional glycosyltransferase
- Peptidoglycan glycosyltransferase MtgA
|
|---|
| UniProt accession | P46022 |
|---|
| NCBI Gene ID | 75206064; 947728 |
|---|
| Source species | Escherichia coli (strain K12) |
|---|
| Taxonomic domain | Bacteria |
|---|
| UniProt annotation level | 5 |
|---|
Function and localisation
| Enzyme function | Biosynthetic peptidoglycan transglycosylase (EC 2.4.99.28) |
|---|
| Subcellular location | not curated |
|---|
Structure and mechanism
| Fold type | Lysozyme-type |
|---|
| Catalytic mechanism | Inverting |
|---|
| Cation dependence | No |
|---|
| Oligomeric state | Interacts with FtsI, FtsW and FtsN |
|---|
| PDB structures | not curated |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | not curated |
|---|
| Donor CCD code(s) | not curated |
|---|
| Acceptor substrate(s) | - [GlcNAc-(1->4)-Mur2Ac(oyl-L-Ala-gamma-D-Glu-L-Lys-D-Ala-D-Ala)](n)-di-trans,octa-cis-undecaprenyl diphosphate
- beta-D-GlcNAc-(1->4)-Mur2Ac(oyl-L-Ala-gamma-D-Glu-L-Lys-D-Ala-D-Ala)-di-trans,octa-cis-undecaprenyl diphosphate
|
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
242 aa
MSKSRLTVFSFVRRFLLRLMVVLAVFWGGGIALFSVAPVPFSAVMVERQVSAWLHGNFRYVAHSDWVSMDQISPWMGLAVIAAEDQKFPEHWGFDVASIEKALAHNERNENRIRGASTISQQTAKNLFLWDGRSWVRKGLEAGLTLGIETVWSKKRILTVYLNIAEFGDGVFGVEAAAQRYFHKPASKLTRSEAALLAAVLPNPLRFKVSSPSGYVRSRQAWILRQMYQLGGEPFMQQHQLD
Catalytic domain sequence
168 aa
YVAHSDWVSMDQISPWMGLAVIAAEDQKFPEHWGFDVASIEKALAHNERNENRIRGASTISQQTAKNLFLWDGRSWVRKGLEAGLTLGIETVWSKKRILTVYLNIAEFGDGVFGVEAAAQRYFHKPASKLTRSEAALLAAVLPNPLRFKVSSPSGYVRSRQAWILRQM
