GT-CORE (public beta v1)

Glycosyltransferase Curated Online Resource for Enzymology

Family-organised sequence, structure, mechanism and substrate-specificity records for the CAZy glycosyltransferases

lst

Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58) · N-acetyllactosaminide alpha-2,3-sialyltransferase (EC 2.4.3.6)

GT52Non-model organism · annotation 4–5Fold GT-AInverting4 PDB structure(s)

External resources

Identification and annotation

CAZy familyGT52 · CAZy entry
Gene symbollst
Synonyms / alternate names
  • CMP-N-acetylneuraminate:beta-galactoside alpha-2,3-sialyltransferase
  • Lipooligosaccharide sialyltransferase
UniProt accessionP72097
NCBI Gene IDnot curated
Source speciesNeisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Taxonomic domainBacteria
UniProt annotation level5

Function and localisation

Enzyme functionN-acetyllactosaminide alpha-2,3-sialyltransferase (EC 2.4.3.6)
Subcellular locationnot curated

Structure and mechanism

Fold typeGT-A
Catalytic mechanismInverting
Cation dependenceNo
Oligomeric statehomodimer
PDB structures2YK4, 2YK5, 2YK6, 2YK7

Donor and acceptor specificity

Sugar nucleotide donorCMP-N-acetyl-beta-neuraminate
Donor CCD code(s)NCC
Acceptor substrate(s)a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative
Acceptor CCD / GlycoCTnot curated

Protein sequences

Full protein sequence

371 aa
MGLKKACLTVLCLIVFCFGIFYTFDRVNQGERNAVSLLKEKLFNEEGEPVNLIFCYTILQMKVAERIMAQHPGERFYVVLMSENRNEKYDYYFNQIKDKAERAYFFHLPYGLNKSFNFIPTMAELKVKSMLLPKVKRIYLASLEKVSIAAFLSTYPDAEIKTFDDGTGNLIQSSSYLGDEFSVNGTIKRNFARMMIGDWSIAKTRNASDEHYTIFKGLKNIMDDGRRKMTYLPLFDASELKTGDETGGTVRILLGSPDKEMKEISEKAAKNFKIQYVAPHPRQTYGLSGVTTLNSPYVIEDYILREIKKNPHTRYEIYTFFSGAALTMKDFPNVHVYALKPASLPEDYWLKPVYALFTQSGIPILTFDDKN

Catalytic domain sequence

269 aa
ERFYVVLMSENRNEKYDYYFNQIKDKAERAYFFHLPYGLNKSFNFIPTMAELKVKSMLLPKVKRIYLASLEKVSIAAFLSTYPDAEIKTFDDGTGNLIQSSSYLGDEFSVNGTIKRNFARMMIGDWSIAKTRNASDEHYTIFKGLKNIMDDGRRKMTYLPLFDASELKTGDETGGTVRILLGSPDKEMKEISEKAAKNFKIQYVAPHPRQTYGLSGVTTLNSPYVIEDYILREIKKNPHTRYEIYTFFSGAALTMKDFPNVHVYALKPA