Home/GT Families/GT61/Eogt
Eogt
Drosophila melanogaster · EGF domain-specific O-linked N-acetylglucosamine transferase (EC 2.4.1.255)
GT61Model organism · annotation ≥ 4Fold GT-BInverting
External resources
Identification and annotation
| CAZy family | GT61 · CAZy entry |
|---|
| Gene symbol | Eogt |
|---|
| Synonyms / alternate names | Extracellular O-linked N-acetylglucosamine transferase |
|---|
| UniProt accession | Q9VQB7 |
|---|
| NCBI Gene ID | 33424 |
|---|
| Source species | Drosophila melanogaster |
|---|
| Taxonomic domain | Eukaryota |
|---|
| UniProt annotation level | 4 |
|---|
Function and localisation
| Enzyme function | EGF domain-specific O-linked N-acetylglucosamine transferase (EC 2.4.1.255) |
|---|
| Subcellular location | Endoplasmic reticulum lumen |
|---|
Structure and mechanism
| Fold type | GT-B |
|---|
| Catalytic mechanism | Inverting |
|---|
| Cation dependence | No |
|---|
| Oligomeric state | not curated |
|---|
| PDB structures | not curated |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | UDP-N-acetyl-alpha-D-glucosamine |
|---|
| Donor CCD code(s) | UD1 |
|---|
| Acceptor substrate(s) | - L-seryl-[protein]
- L-threonyl-[protein]
|
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
520 aa
MPILPILIGILHLSLAEDAKHLDGFSLPSLPSEHLIRYLNTFPKLKQQLPTNLTGKGTISSACWGHERDCTPAGRFQTPQCPGEHTGWARSKEAQVRTFYNQADFGYIQEQLSQLTPQCVPTYLGDSSLECTHYLRFCRGRNLLFDFRGLEQREERIRYHMDVLGPGQLLGHCKLNRTRLSGEMEHIGSALQSWGPELRNFDVLPHPVLESGLCDVVVNTPTFIMKIDATYNMYHHFCDFFNLYASLFVNQSHPAAFNTDVQILIWETYPYDSPFRDTFKAFSQRPVWTLSDVEGKRVCFKNVVLPLLPRMIFGLFYNTPIIQGCSNSGLFRAFSEFILHRLQIPYKPPQQKIRITYLSRRTKYRQVLNEDELLAPLEANDKYDVQRVSYERLPFTNQLAITRNTDILIGMHGAGLTHLLFLPNWACIFELYNCEDPNCYKDLARLRGVRYRTWEQRDLVYPQDEGHHPEGGAHAKFTNYSFDVKEFVHLVDGAAEEILSHKEFPRRASENPSKTQRNEL
Catalytic domain sequence
114 aa
LFYNTPIIQGCSNSGLFRAFSEFILHRLQIPYKPPQQKIRITYLSRRTKYRQVLNEDELLAPLEANDKYDVQRVSYERLPFTNQLAITRNTDILIGMHGAGLTHLLFLPNWACI
