GT-CORE (public beta v1)

Glycosyltransferase Curated Online Resource for Enzymology

Family-organised sequence, structure, mechanism and substrate-specificity records for the CAZy glycosyltransferases

b-gt

Enterobacter phage CC31 · Beta glucosyl transferase

GT63Lower annotation levelFold GT-BInvertingannotation < 4

External resources

Identification and annotation

CAZy familyGT63 · CAZy entry
Gene symbolb-gt
Synonyms / alternate namesnot curated
UniProt accessionE5DI50
NCBI Gene ID9926185
Source speciesEnterobacter phage CC31
Taxonomic domainViruses
UniProt annotation level1 below level 4

Function and localisation

Enzyme functionBeta glucosyl transferase
Subcellular locationnot curated

Structure and mechanism

Fold typeGT-B
Catalytic mechanismInverting
Cation dependenceNo
Oligomeric statenot curated
PDB structuresnot curated

Donor and acceptor specificity

Sugar nucleotide donornot curated
Donor CCD code(s)not curated
Acceptor substrate(s)not curated
Acceptor CCD / GlycoCTnot curated

Protein sequences

Full protein sequence

358 aa
MKIAILNLGNNIQGFKTTPASETIYLSECLKDMGLDVDLISMKQTIYGIAFDDVPDPNVYDRVLVVNASLNFYGGEENKMNKAAYMFLNKYKSKIYYLFTDIRLPWEQAWRRMSKKKWSSKYTEEQFIVRSPIRVISQGRDLEQAKRIHSDRLVGVSKDRMEFVHFALDRHKMYHSVFKIAADGIKMRDLIYGGTFRSGNREQKMVEYLFDTGLDVEFFGSVKADQFKNPEFPWTTPPVFPGKVDSREMVQRNSTAYATIVLGDKTYDNNQITPRVWEALASTAVAFFDSTFDPDMNIMEGNEFFYVSNRQELVDKINKIKNDEDFRIETLEYQHKILQKYLDEKPIWQAEFKKAIEI

Catalytic domain sequence

151 aa
MKIAILNLGNNIQGFKTTPASETIYLSECLKDMGLDVDLISMKQTIYGIAFDDVPDPNVYDRVLVVNASLNFYGGEENKMNKAAYMFLNKYKSKIYYLFTDIRLPWEQAWRRMSKKKWSSKYTEEQFIVRSPIRVISQGRDLEQAKRIHSD