Home/GT Families/GT7/A0A384NY44
A0A384NY44
Homo sapiens · Beta-1,4-galactosyltransferase (EC 2.4.1.-)
GT7Model organism · annotation ≥ 4Fold GT-AInverting
External resources
Identification and annotation
| CAZy family | GT7 · CAZy entry |
| Gene symbol | not curated |
| Synonyms / alternate names | not curated |
| UniProt accession | A0A384NY44 |
| NCBI Gene ID | 8703 |
| Source species | Homo sapiens |
| Taxonomic domain | Eukaryota |
| UniProt annotation level | 4 |
Function and localisation
| Enzyme function | Beta-1,4-galactosyltransferase (EC 2.4.1.-) |
| Subcellular location | - Golgi apparatus membrane
- Golgi apparatus, Golgi stack membrane
|
Structure and mechanism
| Fold type | GT-A |
| Catalytic mechanism | Inverting |
| Cation dependence | Yes (Mn2+) |
| Oligomeric state | not curated |
| PDB structures | not curated |
Donor and acceptor specificity
| Sugar nucleotide donor | UDP-alpha-D-galactose |
| Donor CCD code(s) | GDU |
| Acceptor substrate(s) | - N-acetyl-D-glucosamine
- a beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1)-Cer(d18:1(4E))
- a beta-D-glucosylceramide
- a neolactoside IV(3)-beta-GlcNAc-nLc4Cer
- an N-acetyl-beta-D-glucosaminyl derivative
|
| Acceptor CCD / GlycoCT | not curated |
Protein sequences
Full protein sequence
393 aa
MLRRLLERPCTLALLVGSQLAVMMYLSLGGFRSLSALFGRDQGPTFDYSHPRDVYSNLSHLPGAPGGPPAPQGLPYCPERSPLLVGPVSVSFSPVPSLAEIVERNPRVEPGGRYRPAGCEPRSRTAIIVPHRAREHHLRLLLYHLHPFLQRQQLAYGIYVIHQAGNGTFNRAKLLNVGVREALRDEEWDCLFLHDVDLLPENDHNLYVCDPRGPRHVAVAMNKFGYSLPYPQYFGGVSALTPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPPTSVGHYKMVKHRGDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTNITADIGTDPRGPRAPSGPRYPPGSSQAFRQEMLQRRPPARPGPLSTANHTALRGSH
Catalytic domain sequence
220 aa
RSRTAIIVPHRAREHHLRLLLYHLHPFLQRQQLAYGIYVIHQAGNGTFNRAKLLNVGVREALRDEEWDCLFLHDVDLLPENDHNLYVCDPRGPRHVAVAMNKFGYSLPYPQYFGGVSALTPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPPTSVGHYKMVKHRGDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTNITAD