GT-CORE (public beta v1)

Glycosyltransferase Curated Online Resource for Enzymology

Family-organised sequence, structure, mechanism and substrate-specificity records for the CAZy glycosyltransferases

A0A384NY44

Homo sapiens · Beta-1,4-galactosyltransferase (EC 2.4.1.-)

GT7Model organism · annotation ≥ 4Fold GT-AInverting

External resources

Identification and annotation

CAZy familyGT7 · CAZy entry
Gene symbolnot curated
Synonyms / alternate namesnot curated
UniProt accessionA0A384NY44
NCBI Gene ID8703
Source speciesHomo sapiens
Taxonomic domainEukaryota
UniProt annotation level4

Function and localisation

Enzyme functionBeta-1,4-galactosyltransferase (EC 2.4.1.-)
Subcellular location
  • Golgi apparatus membrane
  • Golgi apparatus, Golgi stack membrane

Structure and mechanism

Fold typeGT-A
Catalytic mechanismInverting
Cation dependenceYes (Mn2+)
Oligomeric statenot curated
PDB structuresnot curated

Donor and acceptor specificity

Sugar nucleotide donorUDP-alpha-D-galactose
Donor CCD code(s)GDU
Acceptor substrate(s)
  • N-acetyl-D-glucosamine
  • a beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1)-Cer(d18:1(4E))
  • a beta-D-glucosylceramide
  • a neolactoside IV(3)-beta-GlcNAc-nLc4Cer
  • an N-acetyl-beta-D-glucosaminyl derivative
Acceptor CCD / GlycoCTnot curated

Protein sequences

Full protein sequence

393 aa
MLRRLLERPCTLALLVGSQLAVMMYLSLGGFRSLSALFGRDQGPTFDYSHPRDVYSNLSHLPGAPGGPPAPQGLPYCPERSPLLVGPVSVSFSPVPSLAEIVERNPRVEPGGRYRPAGCEPRSRTAIIVPHRAREHHLRLLLYHLHPFLQRQQLAYGIYVIHQAGNGTFNRAKLLNVGVREALRDEEWDCLFLHDVDLLPENDHNLYVCDPRGPRHVAVAMNKFGYSLPYPQYFGGVSALTPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPPTSVGHYKMVKHRGDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTNITADIGTDPRGPRAPSGPRYPPGSSQAFRQEMLQRRPPARPGPLSTANHTALRGSH

Catalytic domain sequence

220 aa
RSRTAIIVPHRAREHHLRLLLYHLHPFLQRQQLAYGIYVIHQAGNGTFNRAKLLNVGVREALRDEEWDCLFLHDVDLLPENDHNLYVCDPRGPRHVAVAMNKFGYSLPYPQYFGGVSALTPDQYLKMNGFPNEYWGWGGEDDDIATRVRLAGMKISRPPTSVGHYKMVKHRGDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTNITAD