Home/GT Families/GT75/UPTG
UPTG
Zea mays · Probable UDP-arabinopyranose mutase 1 (EC 5.4.99.30)
GT75Model organism · annotation ≥ 4Fold GT-AInverting
External resources
Identification and annotation
| CAZy family | GT75 · CAZy entry |
|---|
| Gene symbol | UPTG |
|---|
| Synonyms / alternate names | - Amylogenin
- Golgi-associated protein se-wap41
- Reversibly glycosylated polypeptide
- UDP-L-arabinose mutase 1
- UDP-glucose:protein transglucosylase
|
|---|
| UniProt accession | P80607 |
|---|
| NCBI Gene ID | not curated |
|---|
| Source species | Zea mays |
|---|
| Taxonomic domain | Eukaryota |
|---|
| UniProt annotation level | 5 |
|---|
Function and localisation
| Enzyme function | Probable UDP-arabinopyranose mutase 1 (EC 5.4.99.30) |
|---|
| Subcellular location | - Secreted, cell wall
- Cell junction, plasmodesma
- Golgi apparatus
|
|---|
Structure and mechanism
| Fold type | GT-A |
|---|
| Catalytic mechanism | Inverting |
|---|
| Cation dependence | Yes (Mn2+, Mg2+) |
|---|
| Oligomeric state | Homopentamer or homohexamer |
|---|
| PDB structures | not curated |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | UDP-beta-L-arabinofuranose |
|---|
| Donor CCD code(s) | UAD |
|---|
| Acceptor substrate(s) | not curated |
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
364 aa
MAGTVTVPGSSTPSTPLLKDELDIVIPTIRNLDFLEMWRAFFQPYHLIIVQDGDPTKTIKVPEGFDYELYNRNDINRILGPKASCISFKDSACRCFGYMVSKKKYIYTIDDDCFVAKDPSGKDINALEQHIKNLLSPSTPFFFNTLYDPYREGADFVRGYPFSLREGAHTAVSHGLWLNIPDYDAPTQLVKPKERNERYVDAVMTIPKGTLFPMCGMNLAFDRDLIGPAMYFGLMGDGQPIGRYDDMWAGWCVKVICDHLSLGVKTGLPYIWHSKASNPFVNLKKEYKGIFWQEDIIPFFQNVTIPKDCDTVQKCYIYLSGQVKEKLGTIDPYFVKLGDAMVTWIEAWDELNPSTPAAANGKAK
Catalytic domain sequence
335 aa
LKDELDIVIPTIRNLDFLEMWRAFFQPYHLIIVQDGDPTKTIKVPEGFDYELYNRNDINRILGPKASCISFKDSACRCFGYMVSKKKYIYTIDDDCFVAKDPSGKDINALEQHIKNLLSPSTPFFFNTLYDPYREGADFVRGYPFSLREGAHTAVSHGLWLNIPDYDAPTQLVKPKERNERYVDAVMTIPKGTLFPMCGMNLAFDRDLIGPAMYFGLMGDGQPIGRYDDMWAGWCVKVICDHLSLGVKTGLPYIWHSKASNPFVNLKKEYKGIFWQEDIIPFFQNVTIPKDCDTVQKCYIYLSGQVKEKLGTIDPYFVKLGDAMVTWIEAWDELN
