Home/GT Families/GT77/RAY1
RAY1
Arabidopsis thaliana · Beta-arabinofuranosyltransferase RAY1 (EC 2.4.2.-)
GT77Model organism · annotation ≥ 4Fold GT-ARetaining
External resources
Identification and annotation
| CAZy family | GT77 · CAZy entry |
|---|
| Gene symbol | RAY1 |
|---|
| Synonyms / alternate names | Protein REDUCED ARABINOSE YARIV 1 |
|---|
| UniProt accession | F4I6V0 |
|---|
| NCBI Gene ID | 843400 |
|---|
| Source species | Arabidopsis thaliana |
|---|
| Taxonomic domain | Eukaryota |
|---|
| UniProt annotation level | 4 |
|---|
Function and localisation
| Enzyme function | Beta-arabinofuranosyltransferase RAY1 (EC 2.4.2.-) |
|---|
| Subcellular location | not curated |
|---|
Structure and mechanism
| Fold type | GT-A |
|---|
| Catalytic mechanism | Retaining |
|---|
| Cation dependence | Yes (Mn2+) |
|---|
| Oligomeric state | not curated |
|---|
| PDB structures | not curated |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | not curated |
|---|
| Donor CCD code(s) | not curated |
|---|
| Acceptor substrate(s) | not curated |
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
537 aa
MMSRIEAYQSDIAVLMDPETVLLPDFISALSYAHELGRDWLLVSSSVEIPRFPFHWDETRHFWRQDNGKRVRFRELQKMISLRSLQSNSSASKMIMAWNNIDMPLHCGVLPPFLYQRGTHNQWIINEAMSCKRRFVFDATSTISSFFLGNAENIYNRSDNVSEPKTRNWEYVGNSHLGQLYGSLYSRSYTLPKLLKCNRRYIFVSASERSTDLSIPKGKSLGFRTREKISACITRTKSRSLKLDFVQKDETVPPLKFPFDLESLLPLVADKNRTVVLSVAGYSYKDMLMSWVCRLRRLKVPNFLVCALDDETYQFSILQGLPVFFDPYAPKNISFNDCHFGSKCFQRVTKVKSRTVLKILKLGYNVLLSDVDVYWFRNPLPLLQSFGPSVLAAQSDEYNTTAPINRPRRLNSGFYFARSDSPTIAAMEKVVKHAATSGLSEQPSFYDTLCGEGGAYRLGDDRCVEPETNLTVQFLDRELFPNGAYGDLWLKEDVRAECEKKHCFVLHNNWISGRLKKLERQMMKGLWEYDASMRMCV
Catalytic domain sequence
222 aa
KVPNFLVCALDDETYQFSILQGLPVFFDPYAPKNISFNDCHFGSKCFQRVTKVKSRTVLKILKLGYNVLLSDVDVYWFRNPLPLLQSFGPSVLAAQSDEYNTTAPINRPRRLNSGFYFARSDSPTIAAMEKVVKHAATSGLSEQPSFYDTLCGEGGAYRLGDDRCVEPETNLTVQFLDRELFPNGAYGDLWLKEDVRAECEKKHCFVLHNNWISGRLKKLER
