Home/GT Families/GT8/GOLS2
GOLS2
Arabidopsis thaliana · Galactinol synthase 2 (EC 2.4.1.123)
GT8Model organism · annotation ≥ 4Fold GT-ARetaining
External resources
Identification and annotation
| CAZy family | GT8 · CAZy entry |
| Gene symbol | GOLS2 |
| Synonyms / alternate names | not curated |
| UniProt accession | Q9FXB2 |
| NCBI Gene ID | 842114 |
| Source species | Arabidopsis thaliana |
| Taxonomic domain | Eukaryota |
| UniProt annotation level | 4 |
Function and localisation
| Enzyme function | Galactinol synthase 2 (EC 2.4.1.123) |
| Subcellular location | Cytoplasm |
Structure and mechanism
| Fold type | GT-A |
| Catalytic mechanism | Retaining |
| Cation dependence | Yes (Mn2+) |
| Oligomeric state | not curated |
| PDB structures | not curated |
Donor and acceptor specificity
| Sugar nucleotide donor | UDP-alpha-D-galactose |
| Donor CCD code(s) | GDU |
| Acceptor substrate(s) | myo-inositol |
| Acceptor CCD / GlycoCT | INS Verified PDB CCD code |
Protein sequences
Full protein sequence
335 aa
MAPEINTKLTVPVHSATGGEKRAYVTFLAGTGDYVKGVVGLAKGLRKAKSKYPLVVAVLPDVPEDHRKQLVDQGCVVKEIEPVYPPENQTEFAMAYYVINYSKLRIWEFVEYNKMIYLDGDIQVFDNIDHLFDLPNGQFYAVMDCFCEKTWSHSPQYKIGYCQQCPDKVTWPEAKLGPKPPLYFNAGMFVYEPNLSTYHNLLETVKIVPPTLFAEQDFLNMYFKDIYKPIPPVYNLVLAMLWRHPENIELDQVKVVHYCAAGAKPWRFTGEEENMDREDIKMLVKKWWDIYNDESLDYKNVVIGDSHKKQQTLQQFIEALSEAGALQYVKAPSAA
Catalytic domain sequence
243 aa
TFLAGTGDYVKGVVGLAKGLRKAKSKYPLVVAVLPDVPEDHRKQLVDQGCVVKEIEPVYPPENQTEFAMAYYVINYSKLRIWEFVEYNKMIYLDGDIQVFDNIDHLFDLPNGQFYAVMDCFCEKTWSHSPQYKIGYCQQCPDKVTWPEAKLGPKPPLYFNAGMFVYEPNLSTYHNLLETVKIVPPTLFAEQDFLNMYFKDIYKPIPPVYNLVLAMLWRHPENIELDQVKVVHYCAAGAKPWRF