GT-CORE (public beta v1)

Glycosyltransferase Curated Online Resource for Enzymology

Family-organised sequence, structure, mechanism and substrate-specificity records for the CAZy glycosyltransferases

GOLS2

Ajuga reptans · Galactinol synthase 2 (EC 2.4.1.123)

GT8Non-model organism · annotation 4–5Fold GT-ARetaining

External resources

Identification and annotation

CAZy familyGT8 · CAZy entry
Gene symbolGOLS2
Synonyms / alternate namesnot curated
UniProt accessionQ9XGN3
NCBI Gene IDnot curated
Source speciesAjuga reptans
Taxonomic domainEukaryota
UniProt annotation level4

Function and localisation

Enzyme functionGalactinol synthase 2 (EC 2.4.1.123)
Subcellular locationCytoplasm

Structure and mechanism

Fold typeGT-A
Catalytic mechanismRetaining
Cation dependenceYes (Mn2+)
Oligomeric statenot curated
PDB structuresnot curated

Donor and acceptor specificity

Sugar nucleotide donorUDP-alpha-D-galactose
Donor CCD code(s)GDU
Acceptor substrate(s)myo-inositol
Acceptor CCD / GlycoCTINS Verified PDB CCD code

Protein sequences

Full protein sequence

292 aa
VGLAKGLRKVGTIYPLVVAVLPDVPPEHRRILVEQGCVVREIEPVYPPENHTEFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFENIDHLFDLENGYFYAVMDCFCEKTWSHTPQYQIGYCQQSPKRVHWPKQLGPKPPLYFNAGMFVYEPSLPTYHDLLHTLKITPPTPFAEQDFLNMFLRDVYRPIPNVYNLVLAMLWRHPENVNLEAVKVVHYCAAGSKPWRYTGEEENMDRNDIKMLVNKWRDIYDDEMLDYNAVADPAADGLQLTAVLTEAAGVVRFIPAPSAA

Catalytic domain sequence

227 aa
AKGLRKVGTIYPLVVAVLPDVPPEHRRILVEQGCVVREIEPVYPPENHTEFAMAYYVINYSKLRIWEFVEYSKMIYLDGDIQVFENIDHLFDLENGYFYAVMDCFCEKTWSHTPQYQIGYCQQSPKRVHWPKQLGPKPPLYFNAGMFVYEPSLPTYHDLLHTLKITPPTPFAEQDFLNMFLRDVYRPIPNVYNLVLAMLWRHPENVNLEAVKVVHYCAAGSKPWRYT