Home/GT Families/GT89/aftB
aftB
Corynebacterium suranareeae · Arabinofuranosyl transferase C
GT89Lower annotation levelFold GT-CRetainingannotation < 4
External resources
Identification and annotation
| CAZy family | GT89 · CAZy entry |
|---|
| Gene symbol | aftB |
|---|
| Synonyms / alternate names | not curated |
|---|
| UniProt accession | A0A169S7F5 |
|---|
| NCBI Gene ID | not curated |
|---|
| Source species | Corynebacterium suranareeae |
|---|
| Taxonomic domain | Bacteria |
|---|
| UniProt annotation level | 1 below level 4 |
|---|
Function and localisation
| Enzyme function | Arabinofuranosyl transferase C |
|---|
| Subcellular location | not curated |
|---|
Structure and mechanism
| Fold type | GT-C |
|---|
| Catalytic mechanism | Retaining |
|---|
| Cation dependence | No |
|---|
| Oligomeric state | not curated |
|---|
| PDB structures | not curated |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | not curated |
|---|
| Donor CCD code(s) | not curated |
|---|
| Acceptor substrate(s) | not curated |
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
679 aa
MTFSPQRPEIEPGNQPDSETESSLQATEKEHASNSDVGSSSGPNYTLITTFLAALTAGIFAFWAGWTRKWISDDGLIVLRTVRNLLAGNGPVFNAGERVEANTSTLWQYCIYLVALVTDYRLEDIALWLALLFTTAASIIGVLGTAHLHRKRIVFLLPAGVIGYFSLSPARDFATSGLEWGLSLMWISIQWLLLVLWATAENKPSGSVVNKLMGTGVLTYALAFWSGLSWLVRPELALYGGLTGVLLLLTAPKWKVALGILAVAIPVPGAYQIFRMGYYGLMVPHTAVAKSASDAVWGTGWEYVEDFTGPYNLWLGLALLLAAGALTVWKTDKQLVLPRGRLGLRTPGMAITLLVICALVHFLYVIRVGGDFMHGRMLLLPLFAILLPVSVVPVNLIDRGWQDFVALALIFSTWVWSTVIFVQGHQWENTGQHVVDERDFWIDFTNRDKDHPPLYAEDFLTVDSMNDYAEVMRDQTLVFPTGQQLNILATADPDTYSWITTPRVEGIEAGDLANIPPTIFHVNLGMTSMNAPLNVRVTDLIGLATPLAARQPRIEGGRIGHDKLMDLEWQVAESATPLAYTPGWIDPEKTYQARQALRHPELIHLFQTYREPMSYHRFVDNIKYALTTGRTLEISDDPEDLLKEFDPMPAEIQEGQETIAWPAEINLDEPRGEPLYSSQ
Catalytic domain sequence
182 aa
VDSMNDYAEVMRDQTLVFPTGQQLNILATADPDTYSWITTPRVEGIEAGDLANIPPTIFHVNLGMTSMNAPLNVRVTDLIGLATPLAARQPRIEGGRIGHDKLMDLEWQVAESATPLAYTPGWIDPEKTYQARQALRHPELIHLFQTYREPMSYHRFVDNIKYALTTGRTLEISDDPEDLLK
