Home/GT Families/GT92/galt-1
galt-1
Caenorhabditis elegans · Beta-1,4-galactosyltransferase galt-1 (EC 2.4.1.-)
GT92Model organism · annotation ≥ 4Fold GT-AInverting
External resources
Identification and annotation
| CAZy family | GT92 · CAZy entry |
|---|
| Gene symbol | galt-1 |
|---|
| Synonyms / alternate names | not curated |
|---|
| UniProt accession | O16374 |
|---|
| NCBI Gene ID | 187430 |
|---|
| Source species | Caenorhabditis elegans |
|---|
| Taxonomic domain | Eukaryota |
|---|
| UniProt annotation level | 5 |
|---|
Function and localisation
| Enzyme function | Beta-1,4-galactosyltransferase galt-1 (EC 2.4.1.-) |
|---|
| Subcellular location | - Golgi apparatus
- Golgi stack membrane
|
|---|
Structure and mechanism
| Fold type | GT-A |
|---|
| Catalytic mechanism | Inverting |
|---|
| Cation dependence | Yes (Mn2+) |
|---|
| Oligomeric state | not curated |
|---|
| PDB structures | not curated |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | not curated |
|---|
| Donor CCD code(s) | not curated |
|---|
| Acceptor substrate(s) | not curated |
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
425 aa
MPRITASKIVLLIALSFCITVIYHFPIATRSSKEYDEYGNEYENVASIESDIKNVRRLLDEVPDPSQNRLQFLKLDEHAFAFSAYTDDRNGNMGYKYVRVLMFITSQDNFSCEINGRKSTDVSLYEFSENHKMKWQMFILNCKLPDGIDFNNVSSVKVIRSTTKQFVDVPIRYRIQDEKIITPDEYDYKMSICVPALFGNGYDAKRIVEFIELNTLQGIEKIYIYTNQKELDGSMKKTLKYYSDNHKITLIDYTLPFREDGVWYHGQLATVTDCLLRNTGITKYTFFNDFDEFFVPVIKSRTLFETISGLFEDPTIGSQRTALKYINAKIKSAPYSLKNIVSEKRIETRFTKCVVRPEMVFEQGIHHTSRVIQDNYKTVSHGGSLLRVYHYKDKKYCCEDESLLKKRHGDQLREKFDSVVGLLDL
Catalytic domain sequence
206 aa
KMSICVPALFGNGYDAKRIVEFIELNTLQGIEKIYIYTNQKELDGSMKKTLKYYSDNHKITLIDYTLPFREDGVWYHGQLATVTDCLLRNTGITKYTFFNDFDEFFVPVIKSRTLFETISGLFEDPTIGSQRTALKYINAKIKSAPYSLKNIVSEKRIETRFTKCVVRPEMVFEQGIHHTSRVIQDNYKTVSHGGSLLRVYHYKDK
