GT-CORE (public beta v1)

Glycosyltransferase Curated Online Resource for Enzymology

Family-organised sequence, structure, mechanism and substrate-specificity records for the CAZy glycosyltransferases

nleB1

Escherichia coli O127:H6 (strain E2348/69 / EPEC) · Protein-arginine N-acetylglucosaminyltransferase NleB1 (EC 2.4.1.-)

GT_NCModel organism · annotation ≥ 4Fold n/a (non-classified)2 PDB structure(s)

External resources

Identification and annotation

CAZy familyGT_NC
Gene symbolnleB1
Synonyms / alternate names
  • nleB
  • Non-LEE-encoded type III effector B1
UniProt accessionB7UI21
NCBI Gene IDnot curated
Source speciesEscherichia coli O127:H6 (strain E2348/69 / EPEC)
Taxonomic domainBacteria
UniProt annotation level5

Function and localisation

Enzyme functionProtein-arginine N-acetylglucosaminyltransferase NleB1 (EC 2.4.1.-)
Subcellular locationnot curated

Structure and mechanism

Fold typen/a (non-classified)
Catalytic mechanismnot curated
Cation dependenceYes (Mn2+)
Oligomeric statenot curated
PDB structures6ACI, 6E66

Donor and acceptor specificity

Sugar nucleotide donorUDP-N-acetyl-alpha-D-glucosamine
Donor CCD code(s)UD1
Acceptor substrate(s)L-arginyl-[protein]
Acceptor CCD / GlycoCTnot curated

Protein sequences

Full protein sequence

329 aa
MLSSLNVLQSSFRGKTALSNSTLLQKVSFAGKEYSLEPIDERTPILFQWFEARPERYEKGEVPILNTKEHPYLSNIINAAKIENERIIGVLVDGNFTYEQKKEFLNLENEHQNIKIIYRADVDFSMYDKKLSDIYLENIHKQESYPASERDNYLLGLLREELKNIPEGKDSLIESYAEKREHTWFDFFRNLAILKAGSLFTETGKTGCHNISPCSGCIYLDADMIITDKLGVLYAPDGIAVHVDCNDEIKSLENGAIVVNRSNHPALLAGLDIMKSKVDAHPYYDGLGKGIKRHFNYSSLHNYNAFCDFIEFKHENIIPNTSMYTSSSW

Catalytic domain sequence

not curated