Home/GT Families/GT_NC/nleB1
nleB1
Escherichia coli O127:H6 (strain E2348/69 / EPEC) · Protein-arginine N-acetylglucosaminyltransferase NleB1 (EC 2.4.1.-)
GT_NCModel organism · annotation ≥ 4Fold n/a (non-classified)2 PDB structure(s)
External resources
Identification and annotation
| CAZy family | GT_NC |
|---|
| Gene symbol | nleB1 |
|---|
| Synonyms / alternate names | - nleB
- Non-LEE-encoded type III effector B1
|
|---|
| UniProt accession | B7UI21 |
|---|
| NCBI Gene ID | not curated |
|---|
| Source species | Escherichia coli O127:H6 (strain E2348/69 / EPEC) |
|---|
| Taxonomic domain | Bacteria |
|---|
| UniProt annotation level | 5 |
|---|
Function and localisation
| Enzyme function | Protein-arginine N-acetylglucosaminyltransferase NleB1 (EC 2.4.1.-) |
|---|
| Subcellular location | not curated |
|---|
Structure and mechanism
| Fold type | n/a (non-classified) |
|---|
| Catalytic mechanism | not curated |
|---|
| Cation dependence | Yes (Mn2+) |
|---|
| Oligomeric state | not curated |
|---|
| PDB structures | 6ACI, 6E66 |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | UDP-N-acetyl-alpha-D-glucosamine |
|---|
| Donor CCD code(s) | UD1 |
|---|
| Acceptor substrate(s) | L-arginyl-[protein] |
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
329 aa
MLSSLNVLQSSFRGKTALSNSTLLQKVSFAGKEYSLEPIDERTPILFQWFEARPERYEKGEVPILNTKEHPYLSNIINAAKIENERIIGVLVDGNFTYEQKKEFLNLENEHQNIKIIYRADVDFSMYDKKLSDIYLENIHKQESYPASERDNYLLGLLREELKNIPEGKDSLIESYAEKREHTWFDFFRNLAILKAGSLFTETGKTGCHNISPCSGCIYLDADMIITDKLGVLYAPDGIAVHVDCNDEIKSLENGAIVVNRSNHPALLAGLDIMKSKVDAHPYYDGLGKGIKRHFNYSSLHNYNAFCDFIEFKHENIIPNTSMYTSSSW
Catalytic domain sequence
not curated
