Home/GT Families/GT_NC/nleB
nleB
Citrobacter rodentium · Protein-arginine N-acetylglucosaminyltransferase NleB (EC 2.4.1.-)
GT_NCNon-model organism · annotation 4–5Fold n/a (non-classified)
External resources
Identification and annotation
| CAZy family | GT_NC |
|---|
| Gene symbol | nleB |
|---|
| Synonyms / alternate names | Non-LEE-encoded type III effector B |
|---|
| UniProt accession | A0A482PDI9 |
|---|
| NCBI Gene ID | not curated |
|---|
| Source species | Citrobacter rodentium |
|---|
| Taxonomic domain | Bacteria |
|---|
| UniProt annotation level | 5 |
|---|
Function and localisation
| Enzyme function | Protein-arginine N-acetylglucosaminyltransferase NleB (EC 2.4.1.-) |
|---|
| Subcellular location | not curated |
|---|
Structure and mechanism
| Fold type | n/a (non-classified) |
|---|
| Catalytic mechanism | not curated |
|---|
| Cation dependence | Yes (Mn2+) |
|---|
| Oligomeric state | not curated |
|---|
| PDB structures | not curated |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | UDP-N-acetyl-alpha-D-glucosamine |
|---|
| Donor CCD code(s) | UD1 |
|---|
| Acceptor substrate(s) | L-arginyl-[protein] |
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
329 aa
MLSPLNVLQFNFRGETALSDSAPLQTVSFAGKDYSMEPIDEKTPILFQWFEARPERYGKGEVPILNTKEHPYLSNIINAAKIENERVIGVLVDGDFTYEQRKEFLSLEDEHQNIKIIYRENVDFSMYDKKLSDIYLENIHEQESYPASERDNYLLGLLREELKNIPYGKDSLIESYAEKRGHTWFDFFRNLAVLKGGGLFTETGKTGCHNISPCGGCIYLDADMIITDKLGVLYAPDGIAVYVDCNDNRKSLENGAIVVNRSNHPALLAGLDIMKSKVDAHPYYDGVGKGLKRHFNYSSLQDYNVFCNFIEFKHKNIIPNTSMYTNSSW
Catalytic domain sequence
not curated
