GT-CORE (public beta v1)

Glycosyltransferase Curated Online Resource for Enzymology

Family-organised sequence, structure, mechanism and substrate-specificity records for the CAZy glycosyltransferases

ALG13

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) · UDP-N-acetylglucosamine transferase subunit ALG13 (EC 2.4.1.141)

GT1Model organism · annotation ≥ 4Fold GT-BInverting2 PDB structure(s)

External resources

Identification and annotation

CAZy familyGT1 · CAZy entry
Gene symbolALG13
Synonyms / alternate namesAsparagine-linked glycosylation protein 13
UniProt accessionP53178
NCBI Gene ID852835
Source speciesSaccharomyces cerevisiae (strain ATCC 204508 / S288c)
Taxonomic domainEukaryota
UniProt annotation level5

Function and localisation

Enzyme functionUDP-N-acetylglucosamine transferase subunit ALG13 (EC 2.4.1.141)
Subcellular locationEndoplasmic reticulum

Structure and mechanism

Fold typeGT-B
Catalytic mechanismInverting
Cation dependenceNo
Oligomeric stateheterodimer
PDB structures2JZC, 2KS6

Donor and acceptor specificity

Sugar nucleotide donorUDP-N-acetyl-alpha-D-glucosamine
Donor CCD code(s)UD1
Acceptor substrate(s)
  • an N-acetyl-alpha-D-glucosaminyl-diphospho-di-trans
  • poly-cis-dolichol
Acceptor CCD / GlycoCTnot curated

Protein sequences

Full protein sequence

202 aa
MGIIEEKALFVTCGATVPFPKLVSCVLSDEFCQELIQYGFVRLIIQFGRNYSSEFEHLVQERGGQRESQKIPIDQFGCGDTARQYVLMNGKLKVIGFDFSTKMQSIIRDYSDLVISHAGTGSILDSLRLNKPLIVCVNDSLMDNHQQQIADKFVELGYVWSCAPTETGLIAGLRASQTEKLKPFPVSHNPSFERLLVETIYS

Catalytic domain sequence

74 aa
KVIGFDFSTKMQSIIRDYSDLVISHAGTGSILDSLRLNKPLIVCVNDSLMDNHQQQIADKFVELGYVWSCAPTE