Home/GT Families/GT1/ALG14
ALG14
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) · UDP-N-acetylglucosamine transferase subunit ALG14
GT1Model organism · annotation ≥ 4Fold GT-BInverting
External resources
Identification and annotation
| CAZy family | GT1 · CAZy entry |
|---|
| Gene symbol | ALG14 |
|---|
| Synonyms / alternate names | Asparagine-linked glycosylation protein 14 |
|---|
| UniProt accession | P38242 |
|---|
| NCBI Gene ID | 852362 |
|---|
| Source species | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) |
|---|
| Taxonomic domain | Eukaryota |
|---|
| UniProt annotation level | 5 |
|---|
Function and localisation
| Enzyme function | UDP-N-acetylglucosamine transferase subunit ALG14 |
|---|
| Subcellular location | - Endoplasmic reticulum membrane
- Nucleus membrane
|
|---|
Structure and mechanism
| Fold type | GT-B |
|---|
| Catalytic mechanism | Inverting |
|---|
| Cation dependence | No |
|---|
| Oligomeric state | heterodimer |
|---|
| PDB structures | not curated |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | not curated |
|---|
| Donor CCD code(s) | not curated |
|---|
| Acceptor substrate(s) | not curated |
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
237 aa
MKTAYLASLVLIVSTAYVIRLIAILPFFHTQAGTEKDTKDGVNLLKIRKSSKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRFAHFIKKFGHCKVKYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRFAMCGSPHLFLLNGPGTCCIISFWLKIMELLLPLLGSSHIVYVESLARINTPSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV
Catalytic domain sequence
187 aa
SKKPLKIFVFLGSGGHTGEMIRLLENYQDLLLGKSIVYLGYSDEASRQRFAHFIKKFGHCKVKYYEFMKAREVKATLLQSVKTIIGTLVQSFVHVVRIRFAMCGSPHLFLLNGPGTCCIISFWLKIMELLLPLLGSSHIVYVESLARINTPSLTGKILYWVVDEFIVQWQELRDNYLPRSKWFGILV
