Home/GT Families/GT1/ALG14
ALG14
Homo sapiens · UDP-N-acetylglucosamine transferase subunit ALG14
GT1Model organism · annotation ≥ 4Fold GT-BInverting
External resources
Identification and annotation
| CAZy family | GT1 · CAZy entry |
|---|
| Gene symbol | ALG14 |
|---|
| Synonyms / alternate names | Asparagine-linked glycosylation 14 homolog |
|---|
| UniProt accession | Q96F25 |
|---|
| NCBI Gene ID | 199857 |
|---|
| Source species | Homo sapiens |
|---|
| Taxonomic domain | Eukaryota |
|---|
| UniProt annotation level | 5 |
|---|
Function and localisation
| Enzyme function | UDP-N-acetylglucosamine transferase subunit ALG14 |
|---|
| Subcellular location | Endoplasmic reticulum membrane |
|---|
Structure and mechanism
| Fold type | GT-B |
|---|
| Catalytic mechanism | Inverting |
|---|
| Cation dependence | No |
|---|
| Oligomeric state | Forms with ALG13 the active heterodimeric UDP-N-acetylglucos |
|---|
| PDB structures | not curated |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | not curated |
|---|
| Donor CCD code(s) | not curated |
|---|
| Acceptor substrate(s) | not curated |
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
216 aa
MVCVLVLAAAAGAVAVFLILRIWVVLRSMDVTPRESLSILVVAGSGGHTTEILRLLGSLSNAYSPRHYVIADTDEMSANKINSFELDRADRDPSNMYTKYYIHRIPRSREVQQSWPSTVFTTLHSMWLSFPLIHRVKPDLVLCNGPGTCVPICVSALLLGILGIKKVIIVYVESICRVETLSMSGKILFHLSDYFIVQWPALKEKYPKSVYLGRIV
Catalytic domain sequence
123 aa
ILVVAGSGGHTTEILRLLGSLSNAYSPRHYVIADTDEMSANKINSFELDRADRDPSNMYTKYYIHRIPRSREVQQSWPSTVFTTLHSMWLSFPLIHRVKPDLVLCNGPGTCVPICVSALLLGI
