Home/GT Families/GT10/POFUT3
POFUT3
Gallus gallus · GDP-fucose protein O-fucosyltransferase 3 (EC 2.4.1.221)
GT10Model organism · annotation ≥ 4Fold GT-BInverting
External resources
Identification and annotation
| CAZy family | GT10 · CAZy entry |
|---|
| Gene symbol | POFUT3 |
|---|
| Synonyms / alternate names | - FUT10
- Fucosyltransferase X
- Galactoside 3-L-fucosyltransferase 10
|
|---|
| UniProt accession | Q8AWB5 |
|---|
| NCBI Gene ID | not curated |
|---|
| Source species | Gallus gallus |
|---|
| Taxonomic domain | Eukaryota |
|---|
| UniProt annotation level | 4 |
|---|
Function and localisation
| Enzyme function | GDP-fucose protein O-fucosyltransferase 3 (EC 2.4.1.221) |
|---|
| Subcellular location | Endoplasmic reticulum membrane |
|---|
Structure and mechanism
| Fold type | GT-B |
|---|
| Catalytic mechanism | Inverting |
|---|
| Cation dependence | No |
|---|
| Oligomeric state | not curated |
|---|
| PDB structures | not curated |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | GDP-beta-L-fucose |
|---|
| Donor CCD code(s) | GFB |
|---|
| Acceptor substrate(s) | - L-threonyl-[protein]
- L-seryl-[protein]
|
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
475 aa
MVRMRRKRLWASCICFAAFFFLLVTLQVITELGNSENKAPAVSSLHSGPLKPDERHASQLKKNELYSNFRTEPDTDHYPILLWWSPLTGETGRSGQCGEDVCFFTINKTYQHSQMTRAFLFYGTDFSIDSLPLPRKDHHDWALFHEESPKNNYKLFHEPAITLFNHTATFSRHSHLPLTTQYLESIEVLRSLRHMIPVQMKNSLRKRLAPLVYVQSDCNAPSDRDSYVRELMCHIEVDSYGECLHNRDLPQHLRNPSAMDDGNFYKILAQYKFILAFENAICEDYITEKLWRPLMLGVVPVYFGSPSIIDWLPSNKSAILVSSFSHPRELARYIKTLDQNDQEYEAYLEWKLKGDISNPRLLTAMKERKWGVQDVTQDNYIDTFECMVCNRVWENIRREEKGWLPQRWSAQVNHLNCPKPEAFWFSSSNPSQSSLQEMWIASFEQSKKEAWALRQLVERNRNFTTQEFWMLVFKQ
Catalytic domain sequence
186 aa
PLVYVQSDCNAPSDRDSYVRELMCHIEVDSYGECLHNRDLPQHLRNPSAMDDGNFYKILAQYKFILAFENAICEDYITEKLWRPLMLGVVPVYFGSPSIIDWLPSNKSAILVSSFSHPRELARYIKTLDQNDQEYEAYLEWKLKGDISNPRLLTAMKERKWGVQDVTQDNYIDTFECMVCNRVWEN
