Home/GT Families/GT10/POFUT4
POFUT4
Gallus gallus · GDP-fucose protein O-fucosyltransferase 4 (EC 2.4.1.221)
GT10Model organism · annotation ≥ 4Fold GT-BInverting
External resources
Identification and annotation
| CAZy family | GT10 · CAZy entry |
| Gene symbol | POFUT4 |
| Synonyms / alternate names | - FUT11
- Fucosyltransferase XI
- Galactoside 3-L-fucosyltransferase 11
|
| UniProt accession | Q8AWC7 |
| NCBI Gene ID | 395071 |
| Source species | Gallus gallus |
| Taxonomic domain | Eukaryota |
| UniProt annotation level | 4 |
Function and localisation
| Enzyme function | GDP-fucose protein O-fucosyltransferase 4 (EC 2.4.1.221) |
| Subcellular location | Endoplasmic reticulum membrane |
Structure and mechanism
| Fold type | GT-B |
| Catalytic mechanism | Inverting |
| Cation dependence | No |
| Oligomeric state | not curated |
| PDB structures | not curated |
Donor and acceptor specificity
| Sugar nucleotide donor | GDP-beta-L-fucose |
| Donor CCD code(s) | GFB |
| Acceptor substrate(s) | - L-threonyl-[protein]
- L-seryl-[protein]
|
| Acceptor CCD / GlycoCT | not curated |
Protein sequences
Full protein sequence
505 aa
MGGGGPGRAARRGPTCLWVTLALAWGAGSRAAAGDGDGDGEPGPGDAGTPCGAEGWARAAVPPGPAFVAAASYRGPGNNDTRSNKALPILLWWSGSLFPHFPGDTERIDCPRGSCLVTRSRRAARHRRTKALIFYGTDFRAYEAPLPRLPHQTWALFHEESPMNNYLLSHPPGIRLFNYTATFRRESDYPLTLQWLPGAGYLRGPALPLAEKDAWRRRGYGPVLYMQSHCDVPSDRDRYVRELMKYIQVDSYGKCLHNRELPSERLRDTSTATTEDPEFMAFIARYKFHLALENAICNDYMTEKLWRPMHLGAVPVYRGSPAVRDWMPNNLSIILIDDFDSPQELAKYLDFLDKNGEEYMKYLEYKNLDGIKNQFLLESLERREWGVNDMTLPNYLNGFECFICDRENARVRAEQEHKKSRGKTPAPSPHIAHFQHMGCPMPTPGFGSVEDLPGEDSWKEMWLQDYWQSLDQGEALTAMIRHNESHQGRFWDYMHEIFLKRTRQH
Catalytic domain sequence
149 aa
VLYMQSHCDVPSDRDRYVRELMKYIQVDSYGKCLHNRELPSERLRDTSTATTEDPEFMAFIARYKFHLALENAICNDYMTEKLWRPMHLGAVPVYRGSPAVRDWMPNNLSIILIDDFDSPQELAKYLDFLDKNGEEYMKYLEYKNLDGI