Home/GT Families/GT10/Pofut3
Pofut3
Rattus norvegicus · GDP-fucose protein O-fucosyltransferase 3 (EC 2.4.1.221; 2.4.1.-)
GT10Non-model organism · annotation 4–5Fold GT-BInverting
External resources
Identification and annotation
| CAZy family | GT10 · CAZy entry |
|---|
| Gene symbol | Pofut3 |
|---|
| Synonyms / alternate names | - Fut10
- Alpha-(1,3)-fucosyltransferase 10
- Fucosyltransferase X
- Galactoside 3-L-fucosyltransferase 10
|
|---|
| UniProt accession | Q5F2L1 |
|---|
| NCBI Gene ID | 497619 |
|---|
| Source species | Rattus norvegicus |
|---|
| Taxonomic domain | Eukaryota |
|---|
| UniProt annotation level | 4 |
|---|
Function and localisation
| Enzyme function | GDP-fucose protein O-fucosyltransferase 3 (EC 2.4.1.221; 2.4.1.-) |
|---|
| Subcellular location | Endoplasmic reticulum membrane |
|---|
Structure and mechanism
| Fold type | GT-B |
|---|
| Catalytic mechanism | Inverting |
|---|
| Cation dependence | No |
|---|
| Oligomeric state | not curated |
|---|
| PDB structures | not curated |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | GDP-beta-L-fucose |
|---|
| Donor CCD code(s) | GFB |
|---|
| Acceptor substrate(s) | - L-threonyl-[protein]
- L-seryl-[protein]
|
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
483 aa
MVRIPRRKLLPSCLCMTATVFLMVTVQVLVELGKFERKKFKNSDLQDGQKDVEGDPKHLNPLPKKDALALSGRNKVDAGSYPIVLWWSPLTGETGRLGQCGADACFFTINRTFQHHPMTKAFLFYGTDFNIDSLPLPRKAHHDWALFHEESPKNNYKLFHKPVITLFNHTATFSRHSDLPLTTQYLESVEVLKSLRYLVPLQSKNNLRQKLAPLVYVQSDCDPPSDRDSYVRELMAYIEVDSYGECLQNKHLPQQLKNPASMDADAFYRVLAQYKFILAFENAVCDDYITEKFWRPLKLGVVPVYYGSPTIADWLPSNRSAILVSEFSHPRELASFIRRLDYDDGLYETYVEWKLKGEISNQRLLTALREREWGVQDINQDNYIDTFECMVCRRVWANRRLQEQGLPPKQWKADVSHLHCPEPTLFAFSSPASPALRGRSLRELWLPSFQQSKKEAQALRWLVDRNQNFSSEEFWALVFKDSF
Catalytic domain sequence
155 aa
QKLAPLVYVQSDCDPPSDRDSYVRELMAYIEVDSYGECLQNKHLPQQLKNPASMDADAFYRVLAQYKFILAFENAVCDDYITEKFWRPLKLGVVPVYYGSPTIADWLPSNRSAILVSEFSHPRELASFIRRLDYDDGLYETYVEWKLKGEISNQR
