Home/GT Families/GT31/B3galt5
B3galt5
Mus musculus · Beta-1,3-galactosyltransferase 5 (EC 2.4.1.-)
GT31Non-model organism · annotation 4–5Fold GT-AInverting
External resources
Identification and annotation
| CAZy family | GT31 · CAZy entry |
|---|
| Gene symbol | B3galt5 |
|---|
| Synonyms / alternate names | - B3gt5
- Beta-3-Gx-T5
- Stage-specific embryonic antigen 3 synthase
- UDP-Gal:beta-GlcNAc beta-1,3-galactosyltransferase 5
- UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase 5
|
|---|
| UniProt accession | Q9JI67 |
|---|
| NCBI Gene ID | 93961 |
|---|
| Source species | Mus musculus |
|---|
| Taxonomic domain | Eukaryota |
|---|
| UniProt annotation level | 4 |
|---|
Function and localisation
| Enzyme function | Beta-1,3-galactosyltransferase 5 (EC 2.4.1.-) |
|---|
| Subcellular location | Golgi apparatus membrane |
|---|
Structure and mechanism
| Fold type | GT-A |
|---|
| Catalytic mechanism | Inverting |
|---|
| Cation dependence | Yes (Mn2+) |
|---|
| Oligomeric state | not curated |
|---|
| PDB structures | not curated |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | UDP-alpha-D-galactose |
|---|
| Donor CCD code(s) | GDU |
|---|
| Acceptor substrate(s) | a globoside Gb4Cer (d18:1(4E)) |
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
308 aa
MAHMKTRLVYASILMMGALCLYFSMDSFRELPFVFKKSHGKFLQIPDIDCKQKPPFLVLLVTSSHKQLAARMAIRKTWGRETSVQGQQVRTFFLLGTSDSTEEMDATTLESEQHRDIIQKDFKDAYFNLTLKTMMGMEWVYHFCPQTAYVMKTDSDMFVNVGYLTELLLKKNKTTRFFTGYIKPHDFPIRQKFNKWFVSKFEYPWDRYPPFCSGTGYVFSSDVAIQVYNVSESVPFIKLEDVFVGLCLAKLKIRPEELHTKQTFFPGGLRFSVCRFQKIVACHFMKPQDLLTYWQALENSKEQDCPAV
Catalytic domain sequence
189 aa
ARMAIRKTWGRETSVQGQQVRTFFLLGTSDSTEEMDATTLESEQHRDIIQKDFKDAYFNLTLKTMMGMEWVYHFCPQTAYVMKTDSDMFVNVGYLTELLLKKNKTTRFFTGYIKPHDFPIRQKFNKWFVSKFEYPWDRYPPFCSGTGYVFSSDVAIQVYNVSESVPFIKLEDVFVGLCLAKLKIRPEEL
