Home/GT Families/GT31/B3glct
B3glct
Mus musculus · Beta-1,3-glucosyltransferase (EC 2.4.1.-)
GT31Non-model organism · annotation 4–5Fold GT-AInverting
External resources
Identification and annotation
| CAZy family | GT31 · CAZy entry |
| Gene symbol | B3glct |
| Synonyms / alternate names | - B3galtl
- Gm1057
- Beta 3-glucosyltransferase
- Beta-3-glycosyltransferase-like
|
| UniProt accession | Q8BHT6 |
| NCBI Gene ID | 381694 |
| Source species | Mus musculus |
| Taxonomic domain | Eukaryota |
| UniProt annotation level | 5 |
Function and localisation
| Enzyme function | Beta-1,3-glucosyltransferase (EC 2.4.1.-) |
| Subcellular location | Endoplasmic reticulum membrane |
Structure and mechanism
| Fold type | GT-A |
| Catalytic mechanism | Inverting |
| Cation dependence | Yes (Mn2+) |
| Oligomeric state | not curated |
| PDB structures | not curated |
Donor and acceptor specificity
| Sugar nucleotide donor | UDP-alpha-D-glucose |
| Donor CCD code(s) | UPG |
| Acceptor substrate(s) | - 3-O-(alpha-L-fucosyl)-L-seryl-[protein]
- 3-O-(alpha-L-fucosyl)-L-threonyl-[protein]
|
| Acceptor CCD / GlycoCT | not curated |
Protein sequences
Full protein sequence
489 aa
MRPPALLALFSCSAAFALMSEEIKEKVTPSQDLRQSSLPGRHDIDLKEIVFVIQSQSNSFHAKRAEQLKKNILKQAANLTQDLPRVLLLHQLAKQEGAWTILPLLPHFSVTYSKNSAWIFFCEEETRLQIPRLLDTLRRYDPSKEWFLGKALYDEESTIIHHYAFSENPTVFKYPDFAAGWALSIPLVNKLAKRLKSEALKSDFTIDLKHEIALYIWDKGGGPALTPVPEFCTEDVDPRCVTTFHSFLPLCGVPVKKEEIFVAVKTCKKFHADRIPIVKKTWAAQASLIEYYSDYAETAIPTVDLGIPNTDRGHCGKTFAILEKFLNHSHNKISWLVIVDDDTLISISRLRHLLSCYDSSDPVFLGERYGYGLGTGGYSYVTGGGGMVFSREAIRRLLVSSCRCYSNDAPDDMVLGMCFSGLGVPVTHSPLFHQARPVDYPKDYLAHQIPVSFHKHWHIDPVKVYLTWLAPSEEDQATQETQKDPREEL
Catalytic domain sequence
112 aa
ILEKFLNHSHNKISWLVIVDDDTLISISRLRHLLSCYDSSDPVFLGERYGYGLGTGGYSYVTGGGGMVFSREAIRRLLVSSCRCYSNDAPDDMVLGMCFSGLGVPVTHSPLF