Home/GT Families/GT31/B3gnt7
B3gnt7
Mus musculus · UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 (EC 2.4.1.-)
GT31Non-model organism · annotation 4–5Fold GT-AInverting
External resources
Identification and annotation
| CAZy family | GT31 · CAZy entry |
|---|
| Gene symbol | B3gnt7 |
|---|
| Synonyms / alternate names | not curated |
|---|
| UniProt accession | Q8K0J2 |
|---|
| NCBI Gene ID | 227327 |
|---|
| Source species | Mus musculus |
|---|
| Taxonomic domain | Eukaryota |
|---|
| UniProt annotation level | 4 |
|---|
Function and localisation
| Enzyme function | UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 (EC 2.4.1.-) |
|---|
| Subcellular location | Golgi apparatus membrane |
|---|
Structure and mechanism
| Fold type | GT-A |
|---|
| Catalytic mechanism | Inverting |
|---|
| Cation dependence | Yes (Mn2+) |
|---|
| Oligomeric state | not curated |
|---|
| PDB structures | not curated |
|---|
Donor and acceptor specificity
| Sugar nucleotide donor | not curated |
|---|
| Donor CCD code(s) | not curated |
|---|
| Acceptor substrate(s) | not curated |
|---|
| Acceptor CCD / GlycoCT | not curated |
|---|
Protein sequences
Full protein sequence
397 aa
MSLWKKTLYKSVCLALALLVAVTVFQRSVTPGQFLQDPLPPTPGPAKTGNLVNPNSFWKSSKDVAAPTPTVPRGPQVWDVITTNCSININLTHQPWFQSLEPHFRQFLAYRHCRYFPMLLNHPEKCAGDVYMLVVVKSVITQHDRREVIRQTWGHEWESAGLGRGAVRTLFLLGTASKQEERTHYQQLLAYEDRLYADILQWDFLDSFFNLTLKEIHFLKWLDIYCPNVPFVFKGDDDVFVNPTNLLEFLSDRQPQENLFVGDVLKHARPIRKKDNKYYIPAVMYGKATYPPYAGGGGFLMSGSLARQLHHACDTLELFPIDDVFLGMCLEVLGVKPTGHEGFKTFGISRVRSSRMNKEPCFYRAMLVVHKLLPAELLAMWDLVHSNLTCSVKFQVL
Catalytic domain sequence
195 aa
DRREVIRQTWGHEWESAGLGRGAVRTLFLLGTASKQEERTHYQQLLAYEDRLYADILQWDFLDSFFNLTLKEIHFLKWLDIYCPNVPFVFKGDDDVFVNPTNLLEFLSDRQPQENLFVGDVLKHARPIRKKDNKYYIPAVMYGKATYPPYAGGGGFLMSGSLARQLHHACDTLELFPIDDVFLGMCLEVLGVKPT
